252336

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 24649..25292 Replicon plasmid p29_2
Accession NZ_CP101569
Organism Klebsiella pneumoniae subsp. pneumoniae strain KP29

Toxin (Protein)


Gene name vagD Uniprot ID D8L2J9
Locus tag NMY30_RS28425 Protein ID WP_001044770.1
Coordinates 24876..25292 (+) Length 139 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID D5KTK7
Locus tag NMY30_RS28420 Protein ID WP_001261282.1
Coordinates 24649..24879 (+) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NMY30_RS28385 (19872) 19872..20651 - 780 WP_013214009.1 site-specific integrase -
NMY30_RS28390 (20835) 20835..21839 - 1005 WP_011977814.1 hypothetical protein -
NMY30_RS28395 (21869) 21869..22072 - 204 WP_011977813.1 hypothetical protein -
NMY30_RS28400 (22118) 22118..22639 - 522 WP_013214008.1 hypothetical protein -
NMY30_RS28405 (22697) 22697..23089 - 393 WP_011977811.1 hypothetical protein -
NMY30_RS28410 (23126) 23126..24070 - 945 WP_011977810.1 hypothetical protein -
NMY30_RS28415 (24231) 24231..24692 - 462 WP_014343465.1 hypothetical protein -
NMY30_RS28420 (24649) 24649..24879 + 231 WP_001261282.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
NMY30_RS28425 (24876) 24876..25292 + 417 WP_001044770.1 type II toxin-antitoxin system VapC family toxin Toxin
NMY30_RS28430 (25366) 25366..26544 + 1179 Protein_34 AAA family ATPase -
NMY30_RS28435 (26594) 26594..27298 - 705 WP_001067855.1 IS6-like element IS26 family transposase -
NMY30_RS28440 (27359) 27359..29934 + 2576 Protein_36 Tn3-like element TnAs1 family transposase -
NMY30_RS28445 (29971) 29971..30039 - 69 Protein_37 IS6 family transposase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid blaSHV-12 / blaKPC-2 / rmtB / fosA3 / blaCTX-M-65 / catA2 - 1..138059 138059


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(5-129)

Antitoxin

SpoVT-AbrB domain

(7-47)


Sequences

Toxin        


Download         Length: 139 a.a.        Molecular weight: 15106.52 Da        Isoelectric Point: 7.1084

>T252336 WP_001044770.1 NZ_CP101569:24876-25292 [Klebsiella pneumoniae subsp. pneumoniae]
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGQRIVVSAITYSEMRFGATGPKASPRHVELVDAFCARLDAILPWDRA
AVDATTEIKVALRMAGTPIGPNDTAIAGHAIAAGAVLVTNNTREFERVPGLVLEDWVR

Download         Length: 417 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8756.83 Da        Isoelectric Point: 4.4692

>AT252336 WP_001261282.1 NZ_CP101569:24649-24879 [Klebsiella pneumoniae subsp. pneumoniae]
MRTVSIFKNGNNRAIRLPRDLDFEGVSELEIVREGDSIILRPVRPTWGSFAQFEKADPDFMAEREDVVSDEGRFNL

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0H3GYM2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GZG3

References