Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/LOTUS_5_Limkain_b1(toxin) |
| Location | 5364834..5365459 | Replicon | chromosome |
| Accession | NZ_CP101567 | ||
| Organism | Klebsiella pneumoniae subsp. pneumoniae strain KP29 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | R4Y4A3 |
| Locus tag | NMY30_RS26470 | Protein ID | WP_002882817.1 |
| Coordinates | 5364834..5365217 (-) | Length | 128 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | J2DFR0 |
| Locus tag | NMY30_RS26475 | Protein ID | WP_004150355.1 |
| Coordinates | 5365217..5365459 (-) | Length | 81 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NMY30_RS26455 (NMY30_26435) | 5362200..5363102 | + | 903 | WP_002882822.1 | formate dehydrogenase subunit beta | - |
| NMY30_RS26460 (NMY30_26440) | 5363099..5363734 | + | 636 | WP_002882818.1 | formate dehydrogenase cytochrome b556 subunit | - |
| NMY30_RS26465 (NMY30_26445) | 5363731..5364660 | + | 930 | WP_004150358.1 | formate dehydrogenase accessory protein FdhE | - |
| NMY30_RS26470 (NMY30_26450) | 5364834..5365217 | - | 384 | WP_002882817.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| NMY30_RS26475 (NMY30_26455) | 5365217..5365459 | - | 243 | WP_004150355.1 | CopG family transcriptional regulator | Antitoxin |
| NMY30_RS26480 (NMY30_26460) | 5365664..5366581 | + | 918 | WP_002882812.1 | alpha/beta hydrolase | - |
| NMY30_RS26485 (NMY30_26465) | 5366595..5367536 | - | 942 | WP_004178031.1 | fatty acid biosynthesis protein FabY | - |
| NMY30_RS26490 (NMY30_26470) | 5367581..5368018 | - | 438 | WP_002882809.1 | D-aminoacyl-tRNA deacylase | - |
| NMY30_RS26495 (NMY30_26475) | 5368015..5368875 | - | 861 | WP_002882807.1 | virulence factor BrkB family protein | - |
| NMY30_RS26500 (NMY30_26480) | 5368869..5369468 | - | 600 | WP_004151865.1 | glucose-1-phosphatase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 128 a.a. Molecular weight: 14377.62 Da Isoelectric Point: 7.3178
>T252334 WP_002882817.1 NZ_CP101567:c5365217-5364834 [Klebsiella pneumoniae subsp. pneumoniae]
MTSGSALFDTNILIDLFSGRREAKQALEAWPPQNAISLITWMEVMVGAKKYHQEQRTRMALSTFNIINISQDIAERSVAL
RQEYKLKLPDAIILATAQLHRLELITRNTKDFAGIPGVVTPYEIHPE
MTSGSALFDTNILIDLFSGRREAKQALEAWPPQNAISLITWMEVMVGAKKYHQEQRTRMALSTFNIINISQDIAERSVAL
RQEYKLKLPDAIILATAQLHRLELITRNTKDFAGIPGVVTPYEIHPE
Download Length: 384 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GPK8 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GGU9 |