Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 4167367..4167986 Replicon chromosome
Accession NZ_CP101567
Organism Klebsiella pneumoniae subsp. pneumoniae strain KP29

Toxin (Protein)


Gene name Hha Uniprot ID R8WYV2
Locus tag NMY30_RS20715 Protein ID WP_002892050.1
Coordinates 4167768..4167986 (+) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID J2DPF6
Locus tag NMY30_RS20710 Protein ID WP_002892066.1
Coordinates 4167367..4167741 (+) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NMY30_RS20700 (NMY30_20680) 4162519..4163712 + 1194 WP_002892072.1 multidrug efflux RND transporter periplasmic adaptor subunit AcrA -
NMY30_RS20705 (NMY30_20685) 4163735..4166881 + 3147 WP_020326861.1 multidrug efflux RND transporter permease subunit AcrB -
NMY30_RS20710 (NMY30_20690) 4167367..4167741 + 375 WP_002892066.1 Hha toxicity modulator TomB Antitoxin
NMY30_RS20715 (NMY30_20695) 4167768..4167986 + 219 WP_002892050.1 HHA domain-containing protein Toxin
NMY30_RS20720 (NMY30_20700) 4168145..4168711 + 567 WP_002892030.1 maltose O-acetyltransferase -
NMY30_RS20725 (NMY30_20705) 4168683..4168823 - 141 WP_004147370.1 hypothetical protein -
NMY30_RS20730 (NMY30_20710) 4168844..4169314 + 471 WP_002892026.1 YlaC family protein -
NMY30_RS20735 (NMY30_20715) 4169289..4170740 - 1452 WP_002892023.1 PLP-dependent aminotransferase family protein -
NMY30_RS20740 (NMY30_20720) 4170841..4171539 + 699 WP_002892021.1 GNAT family protein -
NMY30_RS20745 (NMY30_20725) 4171536..4171676 - 141 WP_002892018.1 type B 50S ribosomal protein L36 -
NMY30_RS20750 (NMY30_20730) 4171676..4171939 - 264 WP_002892011.1 type B 50S ribosomal protein L31 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-116)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8628.00 Da        Isoelectric Point: 8.9008

>T252330 WP_002892050.1 NZ_CP101567:4167768-4167986 [Klebsiella pneumoniae subsp. pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR

Download         Length: 219 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 14368.06 Da        Isoelectric Point: 4.8989

>AT252330 WP_002892066.1 NZ_CP101567:4167367-4167741 [Klebsiella pneumoniae subsp. pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2P8K6F2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GJ93

References