Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relB-parE/ParE-RHH |
| Location | 1..9795 | Replicon | plasmid p65_2 |
| Accession | NZ_CP101565 | ||
| Organism | Klebsiella pneumoniae subsp. pneumoniae strain KP65 | ||
Toxin (Protein)
| Gene name | parE | Uniprot ID | A0A8J3DTL7 |
| Locus tag | NMY31_RS27685 | Protein ID | WP_071177730.1 |
| Coordinates | 1..315 (+) | Length | 105 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | A0A2X1PRM1 |
| Locus tag | NMY31_RS27680 | Protein ID | WP_000093040.1 |
| Coordinates | 9795..13 (+) | Length | -3260.3333333333 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NMY31_RS27685 (NMY31_27665) | 1..315 | + | 315 | WP_071177730.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| NMY31_RS27690 (NMY31_27670) | 479..907 | + | 429 | WP_001140599.1 | hypothetical protein | - |
| NMY31_RS27695 (NMY31_27675) | 933..1112 | + | 180 | WP_000165970.1 | Rop family plasmid primer RNA-binding protein | - |
| NMY31_RS27700 (NMY31_27680) | 1139..1669 | - | 531 | WP_071177729.1 | hypothetical protein | - |
| NMY31_RS27705 (NMY31_27685) | 1676..2407 | - | 732 | WP_255846784.1 | MobC family replication-relaxation protein | - |
| NMY31_RS27710 (NMY31_27690) | 2407..4371 | - | 1965 | WP_255846785.1 | TraM recognition domain-containing protein | - |
| NMY31_RS27715 (NMY31_27695) | 5855..6004 | - | 150 | WP_032440454.1 | colicin release lysis protein | - |
| NMY31_RS27720 (NMY31_27700) | 6089..6346 | - | 258 | WP_032440455.1 | colicin E3-like toxin immunity protein | - |
| NMY31_RS27725 (NMY31_27705) | 6356..8041 | - | 1686 | WP_032440457.1 | colicin-like bacteriocin tRNase domain-containing protein | - |
| NMY31_RS27730 (NMY31_27710) | 8368..8613 | + | 246 | WP_032440458.1 | hypothetical protein | - |
| NMY31_RS27735 (NMY31_27715) | 8887..9258 | + | 372 | WP_001237044.1 | cell envelope integrity protein TolA | - |
| NMY31_RS27740 (NMY31_27720) | 9255..9620 | + | 366 | WP_072354022.1 | TonB family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | - | 1..10060 | 10060 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 105 a.a. Molecular weight: 11805.73 Da Isoelectric Point: 9.8324
>T252320 WP_071177730.1 NZ_CP101565:1-315 [Klebsiella pneumoniae subsp. pneumoniae]
MPQVTISALAQRDLQRLQDFLKTKNRLAARKGGEVIVRAIQQLKTLPDIGRPVPFLPLEYKELVIGFGDSGYVMLYRHDR
EMDQIVIVTVRHQKESGYPGADSL
MPQVTISALAQRDLQRLQDFLKTKNRLAARKGGEVIVRAIQQLKTLPDIGRPVPFLPLEYKELVIGFGDSGYVMLYRHDR
EMDQIVIVTVRHQKESGYPGADSL
Download Length: 315 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|