Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 4747..5390 Replicon plasmid p65_1
Accession NZ_CP101564
Organism Klebsiella pneumoniae subsp. pneumoniae strain KP65

Toxin (Protein)


Gene name vagD Uniprot ID D8L2J9
Locus tag NMY31_RS26845 Protein ID WP_001044770.1
Coordinates 4747..5163 (-) Length 139 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID D5KTK7
Locus tag NMY31_RS26850 Protein ID WP_001261282.1
Coordinates 5160..5390 (-) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NMY31_RS26815 (1) 1..1253 + 1253 Protein_0 four-carbon acid sugar kinase family protein -
NMY31_RS26820 (1246) 1246..1569 + 324 Protein_1 class II aldolase/adducin family protein -
NMY31_RS26825 (1623) 1623..2327 - 705 WP_001067855.1 IS6-like element IS26 family transposase -
NMY31_RS26830 (2391) 2391..2675 - 285 Protein_3 PAS domain-containing protein -
NMY31_RS26835 (2741) 2741..3445 + 705 WP_001067855.1 IS6-like element IS26 family transposase -
NMY31_RS26840 (3495) 3495..4673 - 1179 Protein_5 AAA family ATPase -
NMY31_RS26845 (4747) 4747..5163 - 417 WP_001044770.1 type II toxin-antitoxin system VapC family toxin Toxin
NMY31_RS26850 (5160) 5160..5390 - 231 WP_001261282.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
NMY31_RS26855 (5347) 5347..5808 + 462 WP_014343465.1 hypothetical protein -
NMY31_RS26860 (5969) 5969..6913 + 945 WP_011977810.1 hypothetical protein -
NMY31_RS26865 (6950) 6950..7342 + 393 WP_011977811.1 hypothetical protein -
NMY31_RS26870 (7400) 7400..7921 + 522 WP_013214008.1 hypothetical protein -
NMY31_RS26875 (7967) 7967..8170 + 204 WP_011977813.1 hypothetical protein -
NMY31_RS26880 (8200) 8200..9204 + 1005 WP_011977814.1 hypothetical protein -
NMY31_RS26885 (9388) 9388..10167 + 780 WP_013214009.1 site-specific integrase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid blaCTX-M-65 / fosA3 / blaTEM-1B / rmtB / blaKPC-2 / blaSHV-12 - 1..126958 126958


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(5-129)

Antitoxin

SpoVT-AbrB domain

(7-47)


Sequences

Toxin        


Download         Length: 139 a.a.        Molecular weight: 15106.52 Da        Isoelectric Point: 7.1084

>T252313 WP_001044770.1 NZ_CP101564:c5163-4747 [Klebsiella pneumoniae subsp. pneumoniae]
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGQRIVVSAITYSEMRFGATGPKASPRHVELVDAFCARLDAILPWDRA
AVDATTEIKVALRMAGTPIGPNDTAIAGHAIAAGAVLVTNNTREFERVPGLVLEDWVR

Download         Length: 417 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8756.83 Da        Isoelectric Point: 4.4692

>AT252313 WP_001261282.1 NZ_CP101564:c5390-5160 [Klebsiella pneumoniae subsp. pneumoniae]
MRTVSIFKNGNNRAIRLPRDLDFEGVSELEIVREGDSIILRPVRPTWGSFAQFEKADPDFMAEREDVVSDEGRFNL

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0H3GYM2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GZG3

References