Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/LOTUS_5_Limkain_b1(toxin) |
Location | 5363264..5363889 | Replicon | chromosome |
Accession | NZ_CP101563 | ||
Organism | Klebsiella pneumoniae subsp. pneumoniae strain KP65 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | R4Y4A3 |
Locus tag | NMY31_RS26450 | Protein ID | WP_002882817.1 |
Coordinates | 5363264..5363647 (-) | Length | 128 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | J2DFR0 |
Locus tag | NMY31_RS26455 | Protein ID | WP_004150355.1 |
Coordinates | 5363647..5363889 (-) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NMY31_RS26435 (NMY31_26415) | 5360630..5361532 | + | 903 | WP_002882822.1 | formate dehydrogenase subunit beta | - |
NMY31_RS26440 (NMY31_26420) | 5361529..5362164 | + | 636 | WP_002882818.1 | formate dehydrogenase cytochrome b556 subunit | - |
NMY31_RS26445 (NMY31_26425) | 5362161..5363090 | + | 930 | WP_004150358.1 | formate dehydrogenase accessory protein FdhE | - |
NMY31_RS26450 (NMY31_26430) | 5363264..5363647 | - | 384 | WP_002882817.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
NMY31_RS26455 (NMY31_26435) | 5363647..5363889 | - | 243 | WP_004150355.1 | CopG family transcriptional regulator | Antitoxin |
NMY31_RS26460 (NMY31_26440) | 5364094..5365011 | + | 918 | WP_002882812.1 | alpha/beta hydrolase | - |
NMY31_RS26465 (NMY31_26445) | 5365025..5365966 | - | 942 | WP_004178031.1 | fatty acid biosynthesis protein FabY | - |
NMY31_RS26470 (NMY31_26450) | 5366011..5366448 | - | 438 | WP_002882809.1 | D-aminoacyl-tRNA deacylase | - |
NMY31_RS26475 (NMY31_26455) | 5366445..5367305 | - | 861 | WP_255846630.1 | virulence factor BrkB family protein | - |
NMY31_RS26480 (NMY31_26460) | 5367299..5367898 | - | 600 | WP_004151865.1 | glucose-1-phosphatase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 128 a.a. Molecular weight: 14377.62 Da Isoelectric Point: 7.3178
>T252312 WP_002882817.1 NZ_CP101563:c5363647-5363264 [Klebsiella pneumoniae subsp. pneumoniae]
MTSGSALFDTNILIDLFSGRREAKQALEAWPPQNAISLITWMEVMVGAKKYHQEQRTRMALSTFNIINISQDIAERSVAL
RQEYKLKLPDAIILATAQLHRLELITRNTKDFAGIPGVVTPYEIHPE
MTSGSALFDTNILIDLFSGRREAKQALEAWPPQNAISLITWMEVMVGAKKYHQEQRTRMALSTFNIINISQDIAERSVAL
RQEYKLKLPDAIILATAQLHRLELITRNTKDFAGIPGVVTPYEIHPE
Download Length: 384 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GPK8 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GGU9 |