Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-RelB |
Location | 4883029..4883545 | Replicon | chromosome |
Accession | NZ_CP101563 | ||
Organism | Klebsiella pneumoniae subsp. pneumoniae strain KP65 |
Toxin (Protein)
Gene name | relE | Uniprot ID | J2XDK6 |
Locus tag | NMY31_RS24145 | Protein ID | WP_002886902.1 |
Coordinates | 4883029..4883313 (-) | Length | 95 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | R4Y888 |
Locus tag | NMY31_RS24150 | Protein ID | WP_002886901.1 |
Coordinates | 4883303..4883545 (-) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NMY31_RS24120 (NMY31_24100) | 4878513..4878776 | - | 264 | WP_004152271.1 | PTS sugar transporter subunit IIB | - |
NMY31_RS24125 (NMY31_24105) | 4878906..4879079 | + | 174 | WP_002886906.1 | hypothetical protein | - |
NMY31_RS24130 (NMY31_24110) | 4879082..4879825 | + | 744 | WP_002886905.1 | MurR/RpiR family transcriptional regulator | - |
NMY31_RS24135 (NMY31_24115) | 4880182..4882320 | + | 2139 | WP_002886904.1 | anaerobic ribonucleoside-triphosphate reductase | - |
NMY31_RS24140 (NMY31_24120) | 4882561..4883025 | + | 465 | WP_002886903.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
NMY31_RS24145 (NMY31_24125) | 4883029..4883313 | - | 285 | WP_002886902.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
NMY31_RS24150 (NMY31_24130) | 4883303..4883545 | - | 243 | WP_002886901.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
NMY31_RS24155 (NMY31_24135) | 4883623..4885533 | - | 1911 | WP_004152270.1 | PRD domain-containing protein | - |
NMY31_RS24160 (NMY31_24140) | 4885556..4886710 | - | 1155 | WP_002886900.1 | lactonase family protein | - |
NMY31_RS24165 (NMY31_24145) | 4886776..4887516 | - | 741 | WP_002886899.1 | KDGP aldolase family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 11125.95 Da Isoelectric Point: 10.3787
>T252310 WP_002886902.1 NZ_CP101563:c4883313-4883029 [Klebsiella pneumoniae subsp. pneumoniae]
MTYELEFDPRAWREWQKPGETVKKQFKNKLQQIVQNPRIESARLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
MTYELEFDPRAWREWQKPGETVKKQFKNKLQQIVQNPRIESARLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GMH2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GLP0 |