Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 4166651..4167270 Replicon chromosome
Accession NZ_CP101563
Organism Klebsiella pneumoniae subsp. pneumoniae strain KP65

Toxin (Protein)


Gene name Hha Uniprot ID R8WYV2
Locus tag NMY31_RS20705 Protein ID WP_002892050.1
Coordinates 4167052..4167270 (+) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID J2DPF6
Locus tag NMY31_RS20700 Protein ID WP_002892066.1
Coordinates 4166651..4167025 (+) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NMY31_RS20690 (NMY31_20670) 4161803..4162996 + 1194 WP_002892072.1 multidrug efflux RND transporter periplasmic adaptor subunit AcrA -
NMY31_RS20695 (NMY31_20675) 4163019..4166165 + 3147 WP_220224624.1 multidrug efflux RND transporter permease subunit AcrB -
NMY31_RS20700 (NMY31_20680) 4166651..4167025 + 375 WP_002892066.1 Hha toxicity modulator TomB Antitoxin
NMY31_RS20705 (NMY31_20685) 4167052..4167270 + 219 WP_002892050.1 HHA domain-containing protein Toxin
NMY31_RS20710 (NMY31_20690) 4167429..4167995 + 567 WP_002892030.1 maltose O-acetyltransferase -
NMY31_RS20715 (NMY31_20695) 4167967..4168107 - 141 WP_004147370.1 hypothetical protein -
NMY31_RS20720 (NMY31_20700) 4168128..4168598 + 471 WP_002892026.1 YlaC family protein -
NMY31_RS20725 (NMY31_20705) 4168573..4170024 - 1452 WP_002892023.1 PLP-dependent aminotransferase family protein -
NMY31_RS20730 (NMY31_20710) 4170125..4170823 + 699 WP_002892021.1 GNAT family protein -
NMY31_RS20735 (NMY31_20715) 4170820..4170960 - 141 WP_002892018.1 type B 50S ribosomal protein L36 -
NMY31_RS20740 (NMY31_20720) 4170960..4171223 - 264 WP_002892011.1 type B 50S ribosomal protein L31 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-116)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8628.00 Da        Isoelectric Point: 8.9008

>T252308 WP_002892050.1 NZ_CP101563:4167052-4167270 [Klebsiella pneumoniae subsp. pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR

Download         Length: 219 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 14368.06 Da        Isoelectric Point: 4.8989

>AT252308 WP_002892066.1 NZ_CP101563:4166651-4167025 [Klebsiella pneumoniae subsp. pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2P8K6F2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GJ93

References