Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 4166651..4167270 | Replicon | chromosome |
| Accession | NZ_CP101563 | ||
| Organism | Klebsiella pneumoniae subsp. pneumoniae strain KP65 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | R8WYV2 |
| Locus tag | NMY31_RS20705 | Protein ID | WP_002892050.1 |
| Coordinates | 4167052..4167270 (+) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | J2DPF6 |
| Locus tag | NMY31_RS20700 | Protein ID | WP_002892066.1 |
| Coordinates | 4166651..4167025 (+) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NMY31_RS20690 (NMY31_20670) | 4161803..4162996 | + | 1194 | WP_002892072.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
| NMY31_RS20695 (NMY31_20675) | 4163019..4166165 | + | 3147 | WP_220224624.1 | multidrug efflux RND transporter permease subunit AcrB | - |
| NMY31_RS20700 (NMY31_20680) | 4166651..4167025 | + | 375 | WP_002892066.1 | Hha toxicity modulator TomB | Antitoxin |
| NMY31_RS20705 (NMY31_20685) | 4167052..4167270 | + | 219 | WP_002892050.1 | HHA domain-containing protein | Toxin |
| NMY31_RS20710 (NMY31_20690) | 4167429..4167995 | + | 567 | WP_002892030.1 | maltose O-acetyltransferase | - |
| NMY31_RS20715 (NMY31_20695) | 4167967..4168107 | - | 141 | WP_004147370.1 | hypothetical protein | - |
| NMY31_RS20720 (NMY31_20700) | 4168128..4168598 | + | 471 | WP_002892026.1 | YlaC family protein | - |
| NMY31_RS20725 (NMY31_20705) | 4168573..4170024 | - | 1452 | WP_002892023.1 | PLP-dependent aminotransferase family protein | - |
| NMY31_RS20730 (NMY31_20710) | 4170125..4170823 | + | 699 | WP_002892021.1 | GNAT family protein | - |
| NMY31_RS20735 (NMY31_20715) | 4170820..4170960 | - | 141 | WP_002892018.1 | type B 50S ribosomal protein L36 | - |
| NMY31_RS20740 (NMY31_20720) | 4170960..4171223 | - | 264 | WP_002892011.1 | type B 50S ribosomal protein L31 | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T252308 WP_002892050.1 NZ_CP101563:4167052-4167270 [Klebsiella pneumoniae subsp. pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14368.06 Da Isoelectric Point: 4.8989
>AT252308 WP_002892066.1 NZ_CP101563:4166651-4167025 [Klebsiella pneumoniae subsp. pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2P8K6F2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GJ93 |