Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/ParE-RelB
Location 4182..4716 Replicon plasmid p72_4
Accession NZ_CP101558
Organism Klebsiella pneumoniae subsp. pneumoniae strain KP72

Toxin (Protein)


Gene name relE Uniprot ID A0A6P1V8P2
Locus tag NMY33_RS28925 Protein ID WP_000143805.1
Coordinates 4182..4472 (-) Length 97 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID A0A7I6XZR7
Locus tag NMY33_RS28930 Protein ID WP_000104338.1
Coordinates 4462..4716 (-) Length 85 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NMY33_RS28895 (NMY33_28880) 1..249 + 249 WP_058670686.1 replication regulatory protein RepA -
NMY33_RS28900 (NMY33_28885) 367..527 + 161 Protein_1 protein CopA/IncA -
NMY33_RS28905 (NMY33_28890) 494..571 + 78 WP_011201829.1 RepA leader peptide Tap -
NMY33_RS28910 (NMY33_28895) 552..1427 + 876 WP_094935765.1 incFII family plasmid replication initiator RepA -
NMY33_RS28915 (NMY33_28900) 2530..3252 + 723 WP_025760202.1 NYN domain-containing protein -
NMY33_RS28920 (NMY33_28905) 3272..3871 + 600 WP_025760201.1 DUF2913 family protein -
NMY33_RS28925 (NMY33_28910) 4182..4472 - 291 WP_000143805.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
NMY33_RS28930 (NMY33_28915) 4462..4716 - 255 WP_000104338.1 type II toxin-antitoxin system RelB/DinJ family antitoxin Antitoxin
NMY33_RS28935 (NMY33_28920) 4873..5583 - 711 WP_059514180.1 tyrosine-type recombinase/integrase -
NMY33_RS28940 (NMY33_28925) 5670..6203 - 534 WP_224019189.1 hypothetical protein -
NMY33_RS28945 (NMY33_28930) 6833..8662 + 1830 WP_025760371.1 hypothetical protein -
NMY33_RS28950 (NMY33_28935) 8912..9361 + 450 WP_045911952.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid blaTEM-1B / ant(3'')-Ia / qacE / sul1 / aph(3')-VI / blaNDM-1 / qnrB6 / mph(A) / aac(3)-IId / aph(6)-Id / aph(3'')-Ib htpB 1..113479 113479


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(5-84)

Antitoxin

RelB antitoxin/Antitoxin DinJ

(1-47)


Sequences

Toxin        


Download         Length: 97 a.a.        Molecular weight: 11463.41 Da        Isoelectric Point: 10.2689

>T252298 WP_000143805.1 NZ_CP101558:c4472-4182 [Klebsiella pneumoniae subsp. pneumoniae]
MTFNVEFDERAFKEWNKLEKTIREQFKKKLKKLQQNPYVESARLHGDLAGCFKIKLRASGFRLIYKVIDDEIVIWVVAVG
KREDEKAYETARKRLL

Download         Length: 291 bp

Antitoxin


Download         Length: 85 a.a.        Molecular weight: 9708.04 Da        Isoelectric Point: 4.4247

>AT252298 WP_000104338.1 NZ_CP101558:c4716-4462 [Klebsiella pneumoniae subsp. pneumoniae]
MSTIQIRVDDELKKDAYQAFEKLNLSPSDALRLFLRYVAENEKLPFAEVSVMVSEDDEDADILAVVRERLKNPARRIRVN
VDDL

Download         Length: 255 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A6P1V8P2

Antitoxin

Source ID Structure
AlphaFold DB A0A7I6XZR7

References