Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 19595..20238 Replicon plasmid p72_3
Accession NZ_CP101557
Organism Klebsiella pneumoniae subsp. pneumoniae strain KP72

Toxin (Protein)


Gene name vagD Uniprot ID Q84A06
Locus tag NMY33_RS28750 Protein ID WP_000754566.1
Coordinates 19822..20238 (+) Length 139 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID Q84A07
Locus tag NMY33_RS28745 Protein ID WP_001261276.1
Coordinates 19595..19825 (+) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NMY33_RS28710 (NMY33_28695) 14714..14983 + 270 WP_000339857.1 hypothetical protein -
NMY33_RS28715 (NMY33_28700) 15160..16026 - 867 WP_004118283.1 replication initiation protein -
NMY33_RS28720 (NMY33_28705) 16556..16660 + 105 WP_032409716.1 hypothetical protein -
NMY33_RS28725 (NMY33_28710) 16789..17046 + 258 WP_000764642.1 hypothetical protein -
NMY33_RS28730 (NMY33_28715) 17104..17880 - 777 WP_000015958.1 site-specific integrase -
NMY33_RS28735 (NMY33_28720) 17877..18620 - 744 WP_000129823.1 hypothetical protein -
NMY33_RS28740 (NMY33_28725) 18671..19021 - 351 WP_000493378.1 hypothetical protein -
NMY33_RS28745 (NMY33_28730) 19595..19825 + 231 WP_001261276.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
NMY33_RS28750 (NMY33_28735) 19822..20238 + 417 WP_000754566.1 type II toxin-antitoxin system VapC family toxin Toxin
NMY33_RS28755 (NMY33_28740) 20442..21298 + 857 Protein_21 IS3-like element ISEc15 family transposase -
NMY33_RS28760 (NMY33_28745) 21580..22656 + 1077 WP_000227969.1 IS110 family transposase -
NMY33_RS28765 (NMY33_28750) 23297..23380 + 84 Protein_23 SOS response-associated peptidase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Mobilizable plasmid aph(4)-Ia / aac(3)-IVa / sul3 / ant(3'')-Ia / cmlA1 / aadA2 - 1..46288 46288


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(6-129)

Antitoxin

SpoVT-AbrB domain

(7-47)


Sequences

Toxin        


Download         Length: 139 a.a.        Molecular weight: 15006.52 Da        Isoelectric Point: 9.2957

>T252297 WP_000754566.1 NZ_CP101557:19822-20238 [Klebsiella pneumoniae subsp. pneumoniae]
MKKTWMLDTNICSFIMREQPAAVLKRLEQAVLRGDRIVVSAVTYAEMRFGATGPKASPRHIQLVDAFCARLDAVLPWDRA
AVDATTDIRVALRLAGTPIGPNDTAIAGHAIAAGAILVTNNVREFARVPGLVLEDWVK

Download         Length: 417 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8721.74 Da        Isoelectric Point: 4.3533

>AT252297 WP_001261276.1 NZ_CP101557:19595-19825 [Klebsiella pneumoniae subsp. pneumoniae]
MRTVSIFKNGNNRAIRLPRDLDFDGVSELEIVREGDSIILRPVRPTWGSFAQLDRADPDFMAEREDVVSDEGRFEP

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A387K1G3

Antitoxin

Source ID Structure
AlphaFold DB A0A387K023

References