Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vagCD/VapC-VagC |
| Location | 19595..20238 | Replicon | plasmid p72_3 |
| Accession | NZ_CP101557 | ||
| Organism | Klebsiella pneumoniae subsp. pneumoniae strain KP72 | ||
Toxin (Protein)
| Gene name | vagD | Uniprot ID | Q84A06 |
| Locus tag | NMY33_RS28750 | Protein ID | WP_000754566.1 |
| Coordinates | 19822..20238 (+) | Length | 139 a.a. |
Antitoxin (Protein)
| Gene name | vagC | Uniprot ID | Q84A07 |
| Locus tag | NMY33_RS28745 | Protein ID | WP_001261276.1 |
| Coordinates | 19595..19825 (+) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NMY33_RS28710 (NMY33_28695) | 14714..14983 | + | 270 | WP_000339857.1 | hypothetical protein | - |
| NMY33_RS28715 (NMY33_28700) | 15160..16026 | - | 867 | WP_004118283.1 | replication initiation protein | - |
| NMY33_RS28720 (NMY33_28705) | 16556..16660 | + | 105 | WP_032409716.1 | hypothetical protein | - |
| NMY33_RS28725 (NMY33_28710) | 16789..17046 | + | 258 | WP_000764642.1 | hypothetical protein | - |
| NMY33_RS28730 (NMY33_28715) | 17104..17880 | - | 777 | WP_000015958.1 | site-specific integrase | - |
| NMY33_RS28735 (NMY33_28720) | 17877..18620 | - | 744 | WP_000129823.1 | hypothetical protein | - |
| NMY33_RS28740 (NMY33_28725) | 18671..19021 | - | 351 | WP_000493378.1 | hypothetical protein | - |
| NMY33_RS28745 (NMY33_28730) | 19595..19825 | + | 231 | WP_001261276.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| NMY33_RS28750 (NMY33_28735) | 19822..20238 | + | 417 | WP_000754566.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| NMY33_RS28755 (NMY33_28740) | 20442..21298 | + | 857 | Protein_21 | IS3-like element ISEc15 family transposase | - |
| NMY33_RS28760 (NMY33_28745) | 21580..22656 | + | 1077 | WP_000227969.1 | IS110 family transposase | - |
| NMY33_RS28765 (NMY33_28750) | 23297..23380 | + | 84 | Protein_23 | SOS response-associated peptidase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Mobilizable plasmid | aph(4)-Ia / aac(3)-IVa / sul3 / ant(3'')-Ia / cmlA1 / aadA2 | - | 1..46288 | 46288 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 15006.52 Da Isoelectric Point: 9.2957
>T252297 WP_000754566.1 NZ_CP101557:19822-20238 [Klebsiella pneumoniae subsp. pneumoniae]
MKKTWMLDTNICSFIMREQPAAVLKRLEQAVLRGDRIVVSAVTYAEMRFGATGPKASPRHIQLVDAFCARLDAVLPWDRA
AVDATTDIRVALRLAGTPIGPNDTAIAGHAIAAGAILVTNNVREFARVPGLVLEDWVK
MKKTWMLDTNICSFIMREQPAAVLKRLEQAVLRGDRIVVSAVTYAEMRFGATGPKASPRHIQLVDAFCARLDAVLPWDRA
AVDATTDIRVALRLAGTPIGPNDTAIAGHAIAAGAILVTNNVREFARVPGLVLEDWVK
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A387K1G3 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A387K023 |