Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) tacAT/DUF1778(antitoxin)
Location 146621..147357 Replicon plasmid p72_1
Accession NZ_CP101555
Organism Klebsiella pneumoniae subsp. pneumoniae strain KP72

Toxin (Protein)


Gene name tacT Uniprot ID L7SZ15
Locus tag NMY33_RS27970 Protein ID WP_003026803.1
Coordinates 146875..147357 (+) Length 161 a.a.

Antitoxin (Protein)


Gene name tacA Uniprot ID L7SZ29
Locus tag NMY33_RS27965 Protein ID WP_003026799.1
Coordinates 146621..146887 (+) Length 89 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NMY33_RS27920 (NMY33_27910) 142683..143045 - 363 WP_004152100.1 arsenite efflux transporter metallochaperone ArsD -
NMY33_RS27925 (NMY33_27915) 143095..143445 - 351 WP_004152101.1 As(III)-sensing metalloregulatory transcriptional repressor ArsR -
NMY33_RS27930 (NMY33_27920) 143803..144072 + 270 WP_004152102.1 hypothetical protein -
NMY33_RS27935 (NMY33_27925) 144060..144635 + 576 WP_004152103.1 hypothetical protein -
NMY33_RS27940 (NMY33_27930) 144666..145160 + 495 WP_004152104.1 DNA-binding protein -
NMY33_RS27945 (NMY33_27935) 145204..145572 + 369 WP_004152105.1 hypothetical protein -
NMY33_RS27950 (NMY33_27940) 145606..145809 + 204 WP_004152106.1 HHA domain-containing protein -
NMY33_RS27955 (NMY33_27945) 145858..146115 + 258 WP_004152107.1 hypothetical protein -
NMY33_RS27960 (NMY33_27950) 146191..146445 + 255 WP_004152108.1 hypothetical protein -
NMY33_RS27965 (NMY33_27955) 146621..146887 + 267 WP_003026799.1 DUF1778 domain-containing protein Antitoxin
NMY33_RS27970 (NMY33_27960) 146875..147357 + 483 WP_003026803.1 GNAT family N-acetyltransferase Toxin
NMY33_RS27975 (NMY33_27965) 147558..148961 + 1404 WP_001567368.1 ISNCY-like element ISKpn21 family transposase -
NMY33_RS27980 (NMY33_27970) 148990..149622 - 633 WP_001567369.1 hypothetical protein -
NMY33_RS27985 (NMY33_27975) 149852..151198 + 1347 WP_020314316.1 ISNCY family transposase -
NMY33_RS27990 151359..151490 + 132 WP_004218042.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid catA1 - 1..181183 181183


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

GNAT domain

(45-149)

Antitoxin

Vibrio phage ICP1, Orf50

(6-82)


Sequences

Toxin        


Download         Length: 161 a.a.        Molecular weight: 17353.97 Da        Isoelectric Point: 9.5822

>T252292 WP_003026803.1 NZ_CP101555:146875-147357 [Klebsiella pneumoniae subsp. pneumoniae]
VGRITTPEPLSSSHQLAEFVSGETVLDEWLKQRGLKNQALGAARTFVVCKTGTKQVAGFYSLATGSVNHTEATGSLRRNM
PDPIPVIILARLAVDVSLHGKGVGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKGFYAHHGFKASQTHERTLFLKLP

Download         Length: 483 bp

Antitoxin


Download         Length: 89 a.a.        Molecular weight: 10147.59 Da        Isoelectric Point: 4.5256

>AT252292 WP_003026799.1 NZ_CP101555:146621-146887 [Klebsiella pneumoniae subsp. pneumoniae]
MKSDVQLNLRAKESQRALIDAAAEILHKSRTDFILEMACKAAENVILDRRVFNFNDEQYAEFIDMLDAPVEDEPAINKLL
ARKPQWDV

Download         Length: 267 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0J2GNW6

Antitoxin

Source ID Structure
AlphaFold DB A0A1Q8YL66

References