Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | ykfI-yfjZ/CbtA-CbeA |
Location | 4878881..4879572 | Replicon | chromosome |
Accession | NZ_CP101554 | ||
Organism | Klebsiella pneumoniae subsp. pneumoniae strain KP72 |
Toxin (Protein)
Gene name | ykfI | Uniprot ID | A0A483YFJ1 |
Locus tag | NMY33_RS24195 | Protein ID | WP_025987721.1 |
Coordinates | 4878881..4879222 (-) | Length | 114 a.a. |
Antitoxin (Protein)
Gene name | yfjZ | Uniprot ID | A0A2A5MHA6 |
Locus tag | NMY33_RS24200 | Protein ID | WP_019725272.1 |
Coordinates | 4879246..4879572 (-) | Length | 109 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NMY33_RS24175 (NMY33_24165) | 4875832..4876176 | - | 345 | WP_186970926.1 | hypothetical protein | - |
NMY33_RS24180 (NMY33_24170) | 4876208..4877068 | - | 861 | WP_186970925.1 | hypothetical protein | - |
NMY33_RS24185 (NMY33_24175) | 4877535..4877906 | - | 372 | WP_223369725.1 | hypothetical protein | - |
NMY33_RS24190 (NMY33_24180) | 4877933..4878766 | - | 834 | WP_025987720.1 | DUF4942 domain-containing protein | - |
NMY33_RS24195 (NMY33_24185) | 4878881..4879222 | - | 342 | WP_025987721.1 | TA system toxin CbtA family protein | Toxin |
NMY33_RS24200 (NMY33_24190) | 4879246..4879572 | - | 327 | WP_019725272.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
NMY33_RS24205 (NMY33_24195) | 4879586..4880062 | - | 477 | WP_019725273.1 | DNA repair protein RadC | - |
NMY33_RS24210 (NMY33_24200) | 4880072..4880518 | - | 447 | WP_025987722.1 | antirestriction protein | - |
NMY33_RS24215 (NMY33_24205) | 4880730..4881419 | - | 690 | WP_009309812.1 | hypothetical protein | - |
NMY33_RS24220 (NMY33_24210) | 4881984..4882874 | - | 891 | WP_019725276.1 | YfjP family GTPase | - |
NMY33_RS24225 (NMY33_24215) | 4882957..4884045 | - | 1089 | WP_019725277.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 4861791..4903603 | 41812 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 12867.90 Da Isoelectric Point: 8.5195
>T252288 WP_025987721.1 NZ_CP101554:c4879222-4878881 [Klebsiella pneumoniae subsp. pneumoniae]
MKTLPATIQRAAKPCPSPVTVWQMLLTRLLEQHYGLTLNDTPFSDETVIQEHINAGITLVDAVNFLVEKYELVRIDRRGF
NCQEQSPYLGAVDILRARQATGLLRQRHLPSIR
MKTLPATIQRAAKPCPSPVTVWQMLLTRLLEQHYGLTLNDTPFSDETVIQEHINAGITLVDAVNFLVEKYELVRIDRRGF
NCQEQSPYLGAVDILRARQATGLLRQRHLPSIR
Download Length: 342 bp
Antitoxin
Download Length: 109 a.a. Molecular weight: 12276.01 Da Isoelectric Point: 6.9560
>AT252288 WP_019725272.1 NZ_CP101554:c4879572-4879246 [Klebsiella pneumoniae subsp. pneumoniae]
MPLTDAIQWGLKRSFTPNFGARLVQEGNRLHYLADRANITGKFGDAECLKLEEAFPHFIRQMELMLSTGELNPRHAHSVT
LYHNAFTCEADTLGSCGYVYIVIYPTQR
MPLTDAIQWGLKRSFTPNFGARLVQEGNRLHYLADRANITGKFGDAECLKLEEAFPHFIRQMELMLSTGELNPRHAHSVT
LYHNAFTCEADTLGSCGYVYIVIYPTQR
Download Length: 327 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A483YFJ1 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2A5MHA6 |