Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 4215910..4216529 Replicon chromosome
Accession NZ_CP101554
Organism Klebsiella pneumoniae subsp. pneumoniae strain KP72

Toxin (Protein)


Gene name Hha Uniprot ID R8WYV2
Locus tag NMY33_RS20990 Protein ID WP_002892050.1
Coordinates 4216311..4216529 (+) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID J2DPF6
Locus tag NMY33_RS20985 Protein ID WP_002892066.1
Coordinates 4215910..4216284 (+) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NMY33_RS20975 (NMY33_20965) 4211062..4212255 + 1194 WP_002892072.1 multidrug efflux RND transporter periplasmic adaptor subunit AcrA -
NMY33_RS20980 (NMY33_20970) 4212278..4215424 + 3147 WP_002892069.1 multidrug efflux RND transporter permease subunit AcrB -
NMY33_RS20985 (NMY33_20975) 4215910..4216284 + 375 WP_002892066.1 Hha toxicity modulator TomB Antitoxin
NMY33_RS20990 (NMY33_20980) 4216311..4216529 + 219 WP_002892050.1 HHA domain-containing protein Toxin
NMY33_RS20995 (NMY33_20985) 4216688..4217254 + 567 WP_002892030.1 maltose O-acetyltransferase -
NMY33_RS21000 (NMY33_20990) 4217226..4217366 - 141 WP_004147370.1 hypothetical protein -
NMY33_RS21005 (NMY33_20995) 4217387..4217857 + 471 WP_002892026.1 YlaC family protein -
NMY33_RS21010 (NMY33_21000) 4217832..4219283 - 1452 WP_002892023.1 PLP-dependent aminotransferase family protein -
NMY33_RS21015 (NMY33_21005) 4219384..4220082 + 699 WP_002892021.1 GNAT family protein -
NMY33_RS21020 (NMY33_21010) 4220079..4220219 - 141 WP_002892018.1 type B 50S ribosomal protein L36 -
NMY33_RS21025 (NMY33_21015) 4220219..4220482 - 264 WP_002892011.1 type B 50S ribosomal protein L31 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-116)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8628.00 Da        Isoelectric Point: 8.9008

>T252286 WP_002892050.1 NZ_CP101554:4216311-4216529 [Klebsiella pneumoniae subsp. pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR

Download         Length: 219 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 14368.06 Da        Isoelectric Point: 4.8989

>AT252286 WP_002892066.1 NZ_CP101554:4215910-4216284 [Klebsiella pneumoniae subsp. pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2P8K6F2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GJ93

References