Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-RelB |
Location | 4692165..4692681 | Replicon | chromosome |
Accession | NZ_CP101546 | ||
Organism | Klebsiella pneumoniae subsp. pneumoniae strain KP82 |
Toxin (Protein)
Gene name | relE | Uniprot ID | J2XDK6 |
Locus tag | NMY34_RS23235 | Protein ID | WP_002886902.1 |
Coordinates | 4692165..4692449 (-) | Length | 95 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | R4Y888 |
Locus tag | NMY34_RS23240 | Protein ID | WP_002886901.1 |
Coordinates | 4692439..4692681 (-) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NMY34_RS23210 (NMY34_23195) | 4687649..4687912 | - | 264 | WP_004152271.1 | PTS sugar transporter subunit IIB | - |
NMY34_RS23215 (NMY34_23200) | 4688042..4688215 | + | 174 | WP_002886906.1 | hypothetical protein | - |
NMY34_RS23220 (NMY34_23205) | 4688218..4688961 | + | 744 | WP_002886905.1 | MurR/RpiR family transcriptional regulator | - |
NMY34_RS23225 (NMY34_23210) | 4689318..4691456 | + | 2139 | WP_002886904.1 | anaerobic ribonucleoside-triphosphate reductase | - |
NMY34_RS23230 (NMY34_23215) | 4691697..4692161 | + | 465 | WP_002886903.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
NMY34_RS23235 (NMY34_23220) | 4692165..4692449 | - | 285 | WP_002886902.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
NMY34_RS23240 (NMY34_23225) | 4692439..4692681 | - | 243 | WP_002886901.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
NMY34_RS23245 (NMY34_23230) | 4692759..4694669 | - | 1911 | WP_004152270.1 | PRD domain-containing protein | - |
NMY34_RS23250 (NMY34_23235) | 4694692..4695846 | - | 1155 | WP_002886900.1 | lactonase family protein | - |
NMY34_RS23255 (NMY34_23240) | 4695912..4696652 | - | 741 | WP_002886899.1 | KDGP aldolase family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 11125.95 Da Isoelectric Point: 10.3787
>T252271 WP_002886902.1 NZ_CP101546:c4692449-4692165 [Klebsiella pneumoniae subsp. pneumoniae]
MTYELEFDPRAWREWQKPGETVKKQFKNKLQQIVQNPRIESARLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
MTYELEFDPRAWREWQKPGETVKKQFKNKLQQIVQNPRIESARLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GMH2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GLP0 |