Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 3975112..3975731 Replicon chromosome
Accession NZ_CP101546
Organism Klebsiella pneumoniae subsp. pneumoniae strain KP82

Toxin (Protein)


Gene name Hha Uniprot ID R8WYV2
Locus tag NMY34_RS19795 Protein ID WP_002892050.1
Coordinates 3975513..3975731 (+) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID J2DPF6
Locus tag NMY34_RS19790 Protein ID WP_002892066.1
Coordinates 3975112..3975486 (+) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NMY34_RS19780 (NMY34_19765) 3970264..3971457 + 1194 WP_002892072.1 multidrug efflux RND transporter periplasmic adaptor subunit AcrA -
NMY34_RS19785 (NMY34_19770) 3971480..3974626 + 3147 WP_002892069.1 multidrug efflux RND transporter permease subunit AcrB -
NMY34_RS19790 (NMY34_19775) 3975112..3975486 + 375 WP_002892066.1 Hha toxicity modulator TomB Antitoxin
NMY34_RS19795 (NMY34_19780) 3975513..3975731 + 219 WP_002892050.1 HHA domain-containing protein Toxin
NMY34_RS19800 (NMY34_19785) 3975890..3976456 + 567 WP_002892030.1 maltose O-acetyltransferase -
NMY34_RS19805 (NMY34_19790) 3976428..3976568 - 141 WP_004147370.1 hypothetical protein -
NMY34_RS19810 (NMY34_19795) 3976589..3977059 + 471 WP_002892026.1 YlaC family protein -
NMY34_RS19815 (NMY34_19800) 3977034..3978485 - 1452 WP_002892023.1 PLP-dependent aminotransferase family protein -
NMY34_RS19820 (NMY34_19805) 3978586..3979284 + 699 WP_002892021.1 GNAT family protein -
NMY34_RS19825 (NMY34_19810) 3979281..3979421 - 141 WP_002892018.1 type B 50S ribosomal protein L36 -
NMY34_RS19830 (NMY34_19815) 3979421..3979684 - 264 WP_002892011.1 type B 50S ribosomal protein L31 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-116)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8628.00 Da        Isoelectric Point: 8.9008

>T252269 WP_002892050.1 NZ_CP101546:3975513-3975731 [Klebsiella pneumoniae subsp. pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR

Download         Length: 219 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 14368.06 Da        Isoelectric Point: 4.8989

>AT252269 WP_002892066.1 NZ_CP101546:3975112-3975486 [Klebsiella pneumoniae subsp. pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2P8K6F2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GJ93

References