Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | pasABC/RelE-HTH |
| Location | 2084..2558 | Replicon | plasmid p21_3 |
| Accession | NZ_CP101545 | ||
| Organism | Klebsiella pneumoniae subsp. pneumoniae strain KP21 | ||
Toxin (Protein)
| Gene name | pasB | Uniprot ID | A0A8J3DT22 |
| Locus tag | NMY29_RS27995 | Protein ID | WP_004197762.1 |
| Coordinates | 2292..2558 (+) | Length | 89 a.a. |
Antitoxin (Protein)
| Gene name | pasA | Uniprot ID | S1EJF5 |
| Locus tag | NMY29_RS27990 | Protein ID | WP_000879771.1 |
| Coordinates | 2084..2308 (+) | Length | 75 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NMY29_RS27975 (NMY29_27955) | 220..654 | + | 435 | Protein_1 | relaxase/mobilization nuclease domain-containing protein | - |
| NMY29_RS27980 (NMY29_27960) | 689..1198 | + | 510 | WP_032433972.1 | MbeB family mobilization protein | - |
| NMY29_RS27985 (NMY29_27965) | 1205..1417 | + | 213 | WP_021527181.1 | MbeD family mobilization/exclusion protein | - |
| NMY29_RS27990 (NMY29_27970) | 2084..2308 | + | 225 | WP_000879771.1 | DUF6290 family protein | Antitoxin |
| NMY29_RS27995 (NMY29_27975) | 2292..2558 | + | 267 | WP_004197762.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| NMY29_RS28000 (NMY29_27980) | 2628..2978 | - | 351 | WP_004197756.1 | hypothetical protein | - |
| NMY29_RS28005 (NMY29_27985) | 3044..3589 | - | 546 | WP_023317533.1 | hypothetical protein | - |
| NMY29_RS28010 (NMY29_27990) | 3615..3941 | - | 327 | WP_050516389.1 | hypothetical protein | - |
| NMY29_RS28015 (NMY29_27995) | 5097..5273 | + | 177 | WP_004197757.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Mobilizable plasmid | - | - | 1..5596 | 5596 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 89 a.a. Molecular weight: 10342.96 Da Isoelectric Point: 9.8727
>T252259 WP_004197762.1 NZ_CP101545:2292-2558 [Klebsiella pneumoniae subsp. pneumoniae]
MVWTINYSDRALKSLRKMDKQNARRIVDFMSLRIAVAADPRQSGKPLKGELGEFWRYRVGDYRVLCEIRDDELVILAATI
GHRREVYD
MVWTINYSDRALKSLRKMDKQNARRIVDFMSLRIAVAADPRQSGKPLKGELGEFWRYRVGDYRVLCEIRDDELVILAATI
GHRREVYD
Download Length: 267 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|