Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relB-parE/ParE-RHH |
Location | 6033..6613 | Replicon | plasmid p21_2 |
Accession | NZ_CP101544 | ||
Organism | Klebsiella pneumoniae subsp. pneumoniae strain KP21 |
Toxin (Protein)
Gene name | parE | Uniprot ID | A0A8J3DTL7 |
Locus tag | NMY29_RS27940 | Protein ID | WP_071177730.1 |
Coordinates | 6033..6347 (-) | Length | 105 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | A0A2X1PRM1 |
Locus tag | NMY29_RS27945 | Protein ID | WP_000093040.1 |
Coordinates | 6335..6613 (-) | Length | 93 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NMY29_RS27920 (NMY29_27900) | 1976..3940 | + | 1965 | WP_071177727.1 | TraM recognition domain-containing protein | - |
NMY29_RS27925 (NMY29_27905) | 3940..4671 | + | 732 | WP_071177728.1 | MobC family replication-relaxation protein | - |
NMY29_RS27930 (NMY29_27910) | 5236..5415 | - | 180 | WP_000165970.1 | Rop family plasmid primer RNA-binding protein | - |
NMY29_RS27935 (NMY29_27915) | 5441..5869 | - | 429 | WP_001140599.1 | hypothetical protein | - |
NMY29_RS27940 (NMY29_27920) | 6033..6347 | - | 315 | WP_071177730.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
NMY29_RS27945 (NMY29_27925) | 6335..6613 | - | 279 | WP_000093040.1 | CopG family ribbon-helix-helix protein | Antitoxin |
NMY29_RS27950 (NMY29_27930) | 6788..7153 | - | 366 | WP_072354022.1 | TonB family protein | - |
NMY29_RS27955 (NMY29_27935) | 7150..7521 | - | 372 | WP_001237044.1 | cell envelope integrity protein TolA | - |
NMY29_RS27960 (NMY29_27940) | 7795..8040 | - | 246 | WP_032440458.1 | hypothetical protein | - |
NMY29_RS27965 (NMY29_27945) | 8367..10052 | + | 1686 | WP_032440457.1 | colicin-like bacteriocin tRNase domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | - | 1..10061 | 10061 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 105 a.a. Molecular weight: 11805.73 Da Isoelectric Point: 9.8324
>T252258 WP_071177730.1 NZ_CP101544:c6347-6033 [Klebsiella pneumoniae subsp. pneumoniae]
MPQVTISALAQRDLQRLQDFLKTKNRLAARKGGEVIVRAIQQLKTLPDIGRPVPFLPLEYKELVIGFGDSGYVMLYRHDR
EMDQIVIVTVRHQKESGYPGADSL
MPQVTISALAQRDLQRLQDFLKTKNRLAARKGGEVIVRAIQQLKTLPDIGRPVPFLPLEYKELVIGFGDSGYVMLYRHDR
EMDQIVIVTVRHQKESGYPGADSL
Download Length: 315 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|