Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 123354..123997 Replicon plasmid p21_1
Accession NZ_CP101543
Organism Klebsiella pneumoniae subsp. pneumoniae strain KP21

Toxin (Protein)


Gene name vagD Uniprot ID D8L2J9
Locus tag NMY29_RS27855 Protein ID WP_001044770.1
Coordinates 123354..123770 (-) Length 139 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID D5KTK7
Locus tag NMY29_RS27860 Protein ID WP_001261282.1
Coordinates 123767..123997 (-) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NMY29_RS27825 (118606) 118606..119859 + 1254 Protein_160 four-carbon acid sugar kinase family protein -
NMY29_RS27830 (119852) 119852..120175 + 324 Protein_161 class II aldolase/adducin family protein -
NMY29_RS27835 (120229) 120229..120933 - 705 WP_001067855.1 IS6-like element IS26 family transposase -
NMY29_RS27840 (120997) 120997..121281 - 285 Protein_163 PAS domain-containing protein -
NMY29_RS27845 (121347) 121347..122052 + 706 Protein_164 IS6-like element IS26 family transposase -
NMY29_RS27850 (122102) 122102..123280 - 1179 Protein_165 AAA family ATPase -
NMY29_RS27855 (123354) 123354..123770 - 417 WP_001044770.1 type II toxin-antitoxin system VapC family toxin Toxin
NMY29_RS27860 (123767) 123767..123997 - 231 WP_001261282.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
NMY29_RS27865 (123954) 123954..124415 + 462 WP_014343465.1 hypothetical protein -
NMY29_RS27870 (124576) 124576..125520 + 945 WP_011977810.1 hypothetical protein -
NMY29_RS27875 (125557) 125557..125949 + 393 WP_011977811.1 hypothetical protein -
NMY29_RS27880 (126007) 126007..126528 + 522 WP_013214008.1 hypothetical protein -
NMY29_RS27885 (126574) 126574..126777 + 204 WP_011977813.1 hypothetical protein -
NMY29_RS27890 (126807) 126807..127811 + 1005 WP_011977814.1 hypothetical protein -
NMY29_RS27895 (127995) 127995..128774 + 780 WP_013214009.1 site-specific integrase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid catA2 / blaCTX-M-65 / fosA3 / blaTEM-1B / rmtB / blaKPC-2 / blaSHV-12 - 1..129998 129998


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(5-129)

Antitoxin

SpoVT-AbrB domain

(7-47)


Sequences

Toxin        


Download         Length: 139 a.a.        Molecular weight: 15106.52 Da        Isoelectric Point: 7.1084

>T252257 WP_001044770.1 NZ_CP101543:c123770-123354 [Klebsiella pneumoniae subsp. pneumoniae]
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGQRIVVSAITYSEMRFGATGPKASPRHVELVDAFCARLDAILPWDRA
AVDATTEIKVALRMAGTPIGPNDTAIAGHAIAAGAVLVTNNTREFERVPGLVLEDWVR

Download         Length: 417 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8756.83 Da        Isoelectric Point: 4.4692

>AT252257 WP_001261282.1 NZ_CP101543:c123997-123767 [Klebsiella pneumoniae subsp. pneumoniae]
MRTVSIFKNGNNRAIRLPRDLDFEGVSELEIVREGDSIILRPVRPTWGSFAQFEKADPDFMAEREDVVSDEGRFNL

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0H3GYM2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GZG3

References