Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vagCD/VapC-VagC |
| Location | 123354..123997 | Replicon | plasmid p21_1 |
| Accession | NZ_CP101543 | ||
| Organism | Klebsiella pneumoniae subsp. pneumoniae strain KP21 | ||
Toxin (Protein)
| Gene name | vagD | Uniprot ID | D8L2J9 |
| Locus tag | NMY29_RS27855 | Protein ID | WP_001044770.1 |
| Coordinates | 123354..123770 (-) | Length | 139 a.a. |
Antitoxin (Protein)
| Gene name | vagC | Uniprot ID | D5KTK7 |
| Locus tag | NMY29_RS27860 | Protein ID | WP_001261282.1 |
| Coordinates | 123767..123997 (-) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NMY29_RS27825 (118606) | 118606..119859 | + | 1254 | Protein_160 | four-carbon acid sugar kinase family protein | - |
| NMY29_RS27830 (119852) | 119852..120175 | + | 324 | Protein_161 | class II aldolase/adducin family protein | - |
| NMY29_RS27835 (120229) | 120229..120933 | - | 705 | WP_001067855.1 | IS6-like element IS26 family transposase | - |
| NMY29_RS27840 (120997) | 120997..121281 | - | 285 | Protein_163 | PAS domain-containing protein | - |
| NMY29_RS27845 (121347) | 121347..122052 | + | 706 | Protein_164 | IS6-like element IS26 family transposase | - |
| NMY29_RS27850 (122102) | 122102..123280 | - | 1179 | Protein_165 | AAA family ATPase | - |
| NMY29_RS27855 (123354) | 123354..123770 | - | 417 | WP_001044770.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| NMY29_RS27860 (123767) | 123767..123997 | - | 231 | WP_001261282.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| NMY29_RS27865 (123954) | 123954..124415 | + | 462 | WP_014343465.1 | hypothetical protein | - |
| NMY29_RS27870 (124576) | 124576..125520 | + | 945 | WP_011977810.1 | hypothetical protein | - |
| NMY29_RS27875 (125557) | 125557..125949 | + | 393 | WP_011977811.1 | hypothetical protein | - |
| NMY29_RS27880 (126007) | 126007..126528 | + | 522 | WP_013214008.1 | hypothetical protein | - |
| NMY29_RS27885 (126574) | 126574..126777 | + | 204 | WP_011977813.1 | hypothetical protein | - |
| NMY29_RS27890 (126807) | 126807..127811 | + | 1005 | WP_011977814.1 | hypothetical protein | - |
| NMY29_RS27895 (127995) | 127995..128774 | + | 780 | WP_013214009.1 | site-specific integrase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | catA2 / blaCTX-M-65 / fosA3 / blaTEM-1B / rmtB / blaKPC-2 / blaSHV-12 | - | 1..129998 | 129998 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 15106.52 Da Isoelectric Point: 7.1084
>T252257 WP_001044770.1 NZ_CP101543:c123770-123354 [Klebsiella pneumoniae subsp. pneumoniae]
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGQRIVVSAITYSEMRFGATGPKASPRHVELVDAFCARLDAILPWDRA
AVDATTEIKVALRMAGTPIGPNDTAIAGHAIAAGAVLVTNNTREFERVPGLVLEDWVR
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGQRIVVSAITYSEMRFGATGPKASPRHVELVDAFCARLDAILPWDRA
AVDATTEIKVALRMAGTPIGPNDTAIAGHAIAAGAVLVTNNTREFERVPGLVLEDWVR
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GYM2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GZG3 |