Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 4200690..4201309 Replicon chromosome
Accession NZ_CP101542
Organism Klebsiella pneumoniae subsp. pneumoniae strain KP21

Toxin (Protein)


Gene name Hha Uniprot ID R8WYV2
Locus tag NMY29_RS20910 Protein ID WP_002892050.1
Coordinates 4201091..4201309 (+) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID J2DPF6
Locus tag NMY29_RS20905 Protein ID WP_002892066.1
Coordinates 4200690..4201064 (+) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NMY29_RS20895 (NMY29_20875) 4195842..4197035 + 1194 WP_002892072.1 multidrug efflux RND transporter periplasmic adaptor subunit AcrA -
NMY29_RS20900 (NMY29_20880) 4197058..4200204 + 3147 WP_020326861.1 multidrug efflux RND transporter permease subunit AcrB -
NMY29_RS20905 (NMY29_20885) 4200690..4201064 + 375 WP_002892066.1 Hha toxicity modulator TomB Antitoxin
NMY29_RS20910 (NMY29_20890) 4201091..4201309 + 219 WP_002892050.1 HHA domain-containing protein Toxin
NMY29_RS20915 (NMY29_20895) 4201468..4202034 + 567 WP_002892030.1 maltose O-acetyltransferase -
NMY29_RS20920 (NMY29_20900) 4202006..4202146 - 141 WP_004147370.1 hypothetical protein -
NMY29_RS20925 (NMY29_20905) 4202167..4202637 + 471 WP_002892026.1 YlaC family protein -
NMY29_RS20930 (NMY29_20910) 4202612..4204063 - 1452 WP_002892023.1 PLP-dependent aminotransferase family protein -
NMY29_RS20935 (NMY29_20915) 4204164..4204862 + 699 WP_002892021.1 GNAT family protein -
NMY29_RS20940 (NMY29_20920) 4204859..4204999 - 141 WP_002892018.1 type B 50S ribosomal protein L36 -
NMY29_RS20945 (NMY29_20925) 4204999..4205262 - 264 WP_002892011.1 type B 50S ribosomal protein L31 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-116)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8628.00 Da        Isoelectric Point: 8.9008

>T252246 WP_002892050.1 NZ_CP101542:4201091-4201309 [Klebsiella pneumoniae subsp. pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR

Download         Length: 219 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 14368.06 Da        Isoelectric Point: 4.8989

>AT252246 WP_002892066.1 NZ_CP101542:4200690-4201064 [Klebsiella pneumoniae subsp. pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2P8K6F2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GJ93

References