Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | PfiT-PfiA/ParE(toxin) |
Location | 4804372..4804980 | Replicon | chromosome |
Accession | NZ_CP101540 | ||
Organism | Pseudomonas aeruginosa strain D-2 |
Toxin (Protein)
Gene name | PfiT | Uniprot ID | A0A1B1XUZ2 |
Locus tag | NNL25_RS22415 | Protein ID | WP_003123043.1 |
Coordinates | 4804372..4804719 (-) | Length | 116 a.a. |
Antitoxin (Protein)
Gene name | PfiA | Uniprot ID | A0A0B0C355 |
Locus tag | NNL25_RS22420 | Protein ID | WP_003114155.1 |
Coordinates | 4804729..4804980 (-) | Length | 84 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NNL25_RS22385 (NNL25_22355) | 4799731..4800003 | + | 273 | WP_003134390.1 | cysteine-rich CWC family protein | - |
NNL25_RS22390 (NNL25_22360) | 4800003..4800695 | + | 693 | WP_003085458.1 | 16S rRNA pseudouridine(516) synthase | - |
NNL25_RS22395 (NNL25_22365) | 4800831..4801874 | + | 1044 | WP_255865873.1 | L,D-transpeptidase | - |
NNL25_RS22400 (NNL25_22370) | 4801954..4802691 | + | 738 | WP_003085453.1 | murein L,D-transpeptidase catalytic domain family protein | - |
NNL25_RS22405 (NNL25_22375) | 4803143..4804045 | + | 903 | WP_003085447.1 | (R)-3-hydroxydecanoyl-ACP:CoA transacylase | - |
NNL25_RS22415 (NNL25_22385) | 4804372..4804719 | - | 348 | WP_003123043.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
NNL25_RS22420 (NNL25_22390) | 4804729..4804980 | - | 252 | WP_003114155.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
NNL25_RS22425 (NNL25_22395) | 4805194..4806177 | - | 984 | WP_043178114.1 | tyrosine-type recombinase/integrase | - |
NNL25_RS22430 (NNL25_22400) | 4806177..4807469 | - | 1293 | WP_128711093.1 | hypothetical protein | - |
NNL25_RS22435 (NNL25_22405) | 4807728..4808990 | - | 1263 | WP_223683530.1 | zonular occludens toxin domain-containing protein | - |
NNL25_RS22440 (NNL25_22410) | 4808992..4809342 | - | 351 | WP_003133726.1 | DUF2523 family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | catB7 | - | 4804372..4826203 | 21831 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 116 a.a. Molecular weight: 12990.74 Da Isoelectric Point: 4.4212
>T252235 WP_003123043.1 NZ_CP101540:c4804719-4804372 [Pseudomonas aeruginosa]
MSPVVIRFTDTAEQSIEDQVHHLAPFQGEQAAFQSVLSLLDEIEEKISLAPKGYPVSQQASLLGVLSYRELNTGPYRVFY
EFHEEQGEAAVILVLRQKQSVEQQLIRYCLVGPIE
MSPVVIRFTDTAEQSIEDQVHHLAPFQGEQAAFQSVLSLLDEIEEKISLAPKGYPVSQQASLLGVLSYRELNTGPYRVFY
EFHEEQGEAAVILVLRQKQSVEQQLIRYCLVGPIE
Download Length: 348 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1B1XUZ2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0B0C355 |