Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VagC |
Location | 4515032..4515672 | Replicon | chromosome |
Accession | NZ_CP101540 | ||
Organism | Pseudomonas aeruginosa strain D-2 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | NNL25_RS21020 | Protein ID | WP_003105740.1 |
Coordinates | 4515032..4515442 (-) | Length | 137 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | - |
Locus tag | NNL25_RS21025 | Protein ID | WP_031634724.1 |
Coordinates | 4515442..4515672 (-) | Length | 77 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NNL25_RS20980 (NNL25_20950) | 4510926..4511177 | - | 252 | WP_255865365.1 | hypothetical protein | - |
NNL25_RS20985 (NNL25_20955) | 4511254..4511982 | + | 729 | WP_023123987.1 | TIGR03761 family integrating conjugative element protein | - |
NNL25_RS20990 (NNL25_20960) | 4511988..4512536 | + | 549 | WP_223720502.1 | DUF3158 family protein | - |
NNL25_RS20995 (NNL25_20965) | 4512584..4513414 | + | 831 | WP_023132184.1 | Rha family transcriptional regulator | - |
NNL25_RS21000 (NNL25_20970) | 4513444..4513932 | + | 489 | WP_034038749.1 | single-stranded DNA-binding protein | - |
NNL25_RS21005 (NNL25_20975) | 4514100..4514267 | + | 168 | WP_128729268.1 | CrpP family ICE-associated protein | - |
NNL25_RS21010 (NNL25_20980) | 4514333..4514551 | - | 219 | WP_003105747.1 | hypothetical protein | - |
NNL25_RS21015 (NNL25_20985) | 4514750..4515010 | - | 261 | WP_003105742.1 | hypothetical protein | - |
NNL25_RS21020 (NNL25_20990) | 4515032..4515442 | - | 411 | WP_003105740.1 | tRNA(fMet)-specific endonuclease VapC | Toxin |
NNL25_RS21025 (NNL25_20995) | 4515442..4515672 | - | 231 | WP_031634724.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
NNL25_RS21030 (NNL25_21000) | 4515990..4517909 | + | 1920 | WP_150020274.1 | type I DNA topoisomerase | - |
NNL25_RS21035 (NNL25_21005) | 4517983..4518453 | + | 471 | WP_071535142.1 | hypothetical protein | - |
NNL25_RS21040 (NNL25_21010) | 4519109..4520271 | + | 1163 | WP_086008657.1 | IS3-like element IS222 family transposase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Integrative and Conjugative Element | - | - | 4498896..4539924 | 41028 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 137 a.a. Molecular weight: 15450.81 Da Isoelectric Point: 7.3233
>T252234 WP_003105740.1 NZ_CP101540:c4515442-4515032 [Pseudomonas aeruginosa]
MLKFMLDTNICIFTIKNRPQEVREAFLRHHDQMCISTVTLMELIYGAEKSSNPSRNLADVEGFAARLEVLKYDQEAAAHT
GQLRAELARLGKQIGPYDQMIAGHARSQGLIVVTNNRREFDRVPGLRVEDWVVPIV
MLKFMLDTNICIFTIKNRPQEVREAFLRHHDQMCISTVTLMELIYGAEKSSNPSRNLADVEGFAARLEVLKYDQEAAAHT
GQLRAELARLGKQIGPYDQMIAGHARSQGLIVVTNNRREFDRVPGLRVEDWVVPIV
Download Length: 411 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|