Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/HicB(antitoxin) |
Location | 613577..614214 | Replicon | chromosome |
Accession | NZ_CP101540 | ||
Organism | Pseudomonas aeruginosa strain D-2 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | - |
Locus tag | NNL25_RS02885 | Protein ID | WP_019725766.1 |
Coordinates | 613577..613759 (+) | Length | 61 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | - |
Locus tag | NNL25_RS02890 | Protein ID | WP_019725767.1 |
Coordinates | 613792..614214 (+) | Length | 141 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NNL25_RS02865 (NNL25_02865) | 610557..610700 | + | 144 | WP_153574913.1 | hypothetical protein | - |
NNL25_RS02870 (NNL25_02870) | 610991..611362 | - | 372 | WP_003142777.1 | nuclease-related domain-containing protein | - |
NNL25_RS02875 (NNL25_02875) | 611455..612576 | - | 1122 | WP_003117952.1 | Fic family protein | - |
NNL25_RS02880 (NNL25_02880) | 612835..612972 | - | 138 | WP_003113217.1 | hypothetical protein | - |
NNL25_RS02885 (NNL25_02885) | 613577..613759 | + | 183 | WP_019725766.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
NNL25_RS02890 (NNL25_02890) | 613792..614214 | + | 423 | WP_019725767.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
NNL25_RS02895 (NNL25_02895) | 614460..615431 | - | 972 | WP_058171393.1 | hypothetical protein | - |
NNL25_RS02900 (NNL25_02900) | 615416..616108 | - | 693 | WP_058171392.1 | hypothetical protein | - |
NNL25_RS02905 (NNL25_02905) | 616105..616647 | - | 543 | WP_025982284.1 | hypothetical protein | - |
NNL25_RS02910 (NNL25_02910) | 616644..617567 | - | 924 | WP_031633727.1 | hypothetical protein | - |
NNL25_RS02915 (NNL25_02915) | 617564..618040 | - | 477 | WP_058171390.1 | phage tail assembly chaperone | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 611455..664699 | 53244 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 61 a.a. Molecular weight: 6970.07 Da Isoelectric Point: 10.2954
>T252230 WP_019725766.1 NZ_CP101540:613577-613759 [Pseudomonas aeruginosa]
MKYSEFRRWLKARGVIFEPAKGSHFKVYYGDNQTIFPDHGAKEIGDGLRKKIIKDLGLKD
MKYSEFRRWLKARGVIFEPAKGSHFKVYYGDNQTIFPDHGAKEIGDGLRKKIIKDLGLKD
Download Length: 183 bp
Antitoxin
Download Length: 141 a.a. Molecular weight: 14970.22 Da Isoelectric Point: 4.9047
>AT252230 WP_019725767.1 NZ_CP101540:613792-614214 [Pseudomonas aeruginosa]
MFDYPVTVHEEAGSVWVSCDDVPEMASAGDTVDEALLDAVEGLESALSLYVDRRQSIPLPSKGKAGQSIVRLPALTSAKI
ALWNTMLAQNVGKAELARRLGVNRVQVDRLVDLLHGSKIEAVEHALAILGQRLAVTVIAA
MFDYPVTVHEEAGSVWVSCDDVPEMASAGDTVDEALLDAVEGLESALSLYVDRRQSIPLPSKGKAGQSIVRLPALTSAKI
ALWNTMLAQNVGKAELARRLGVNRVQVDRLVDLLHGSKIEAVEHALAILGQRLAVTVIAA
Download Length: 423 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|