Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | pemIK/MazF(toxin) |
Location | 2562764..2563415 | Replicon | chromosome |
Accession | NZ_CP101538 | ||
Organism | Lacticaseibacillus rhamnosus strain HN067 |
Toxin (Protein)
Gene name | pemK | Uniprot ID | K8Q4Y0 |
Locus tag | NNM43_RS11915 | Protein ID | WP_005686631.1 |
Coordinates | 2562764..2563147 (-) | Length | 128 a.a. |
Antitoxin (Protein)
Gene name | pemI | Uniprot ID | K8QH19 |
Locus tag | NNM43_RS11920 | Protein ID | WP_005686632.1 |
Coordinates | 2563167..2563415 (-) | Length | 83 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NNM43_RS11910 (NNM43_11950) | 2561800..2562327 | - | 528 | WP_005686630.1 | QueT transporter family protein | - |
NNM43_RS11915 (NNM43_11955) | 2562764..2563147 | - | 384 | WP_005686631.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
NNM43_RS11920 (NNM43_11960) | 2563167..2563415 | - | 249 | WP_005686632.1 | antitoxin | Antitoxin |
NNM43_RS11925 (NNM43_11965) | 2563527..2564666 | - | 1140 | WP_005686633.1 | alanine racemase | - |
NNM43_RS11930 (NNM43_11970) | 2564653..2565027 | - | 375 | WP_005686634.1 | holo-ACP synthase | - |
NNM43_RS11935 (NNM43_11975) | 2565196..2566704 | - | 1509 | WP_005686635.1 | DEAD/DEAH box helicase | - |
NNM43_RS11940 (NNM43_11980) | 2566978..2568366 | - | 1389 | WP_005686636.1 | UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D- alanine ligase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 128 a.a. Molecular weight: 13757.03 Da Isoelectric Point: 10.9764
>T252227 WP_005686631.1 NZ_CP101538:c2563147-2562764 [Lacticaseibacillus rhamnosus]
MDVTVKRGDVFFADLSPVVGSEQGGNRPVLIIQNNVGNHYSPTVIVAAITSKIQKPKMPTHVGLRAKQDGVERNSVILLE
QIRTIDKQRLQARVTALSSAKMAAVDRALAISVGLVSLPKPKTYNKN
MDVTVKRGDVFFADLSPVVGSEQGGNRPVLIIQNNVGNHYSPTVIVAAITSKIQKPKMPTHVGLRAKQDGVERNSVILLE
QIRTIDKQRLQARVTALSSAKMAAVDRALAISVGLVSLPKPKTYNKN
Download Length: 384 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|