Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 743194..743969 | Replicon | chromosome |
Accession | NZ_CP101533 | ||
Organism | Klebsiella pneumoniae strain FZKP4523 |
Toxin (Protein)
Gene name | TacT2 | Uniprot ID | A0A1Q4Q548 |
Locus tag | NNL33_RS03715 | Protein ID | WP_004150910.1 |
Coordinates | 743484..743969 (+) | Length | 162 a.a. |
Antitoxin (Protein)
Gene name | TacA2 | Uniprot ID | W8UEW1 |
Locus tag | NNL33_RS03710 | Protein ID | WP_004150912.1 |
Coordinates | 743194..743487 (+) | Length | 98 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NNL33_RS03690 | 738325..739236 | + | 912 | WP_004188550.1 | LysR family transcriptional regulator | - |
NNL33_RS03695 | 739237..740385 | - | 1149 | WP_004150915.1 | PLP-dependent aspartate aminotransferase family protein | - |
NNL33_RS03700 | 740396..741772 | - | 1377 | WP_004217775.1 | cystathionine beta-synthase | - |
NNL33_RS03710 | 743194..743487 | + | 294 | WP_004150912.1 | DUF1778 domain-containing protein | Antitoxin |
NNL33_RS03715 | 743484..743969 | + | 486 | WP_004150910.1 | GNAT family N-acetyltransferase | Toxin |
NNL33_RS03720 | 744673..745266 | + | 594 | WP_004188553.1 | hypothetical protein | - |
NNL33_RS03725 | 745363..745579 | + | 217 | Protein_732 | transposase | - |
NNL33_RS03730 | 746185..747057 | + | 873 | WP_004188557.1 | ParA family protein | - |
NNL33_RS03735 | 747057..747440 | + | 384 | WP_004150906.1 | hypothetical protein | - |
NNL33_RS03740 | 747433..748800 | + | 1368 | WP_004150905.1 | SPI-7-type island replicative DNA helicase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | IScluster/Tn | - | - | 742151..745515 | 3364 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 162 a.a. Molecular weight: 17551.59 Da Isoelectric Point: 8.8818
>T252209 WP_004150910.1 NZ_CP101533:743484-743969 [Klebsiella pneumoniae]
MISAPEPLHAGHILTPFCCGIDSMDHWLKQRAMKNQVTGASRTFVCCDDAKVMAYYSLASSAVTTNTAPGRFRRNMPAPI
PVVVLGRLAVDKSLHGKGVGRALVRDAGLRVIQVAETIGIRGMLVHALSDEARDFYLRVGFEPSPMDPMMLMVTLRDLVN
A
MISAPEPLHAGHILTPFCCGIDSMDHWLKQRAMKNQVTGASRTFVCCDDAKVMAYYSLASSAVTTNTAPGRFRRNMPAPI
PVVVLGRLAVDKSLHGKGVGRALVRDAGLRVIQVAETIGIRGMLVHALSDEARDFYLRVGFEPSPMDPMMLMVTLRDLVN
A
Download Length: 486 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1Q4Q548 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GVL4 |