Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-Phd |
| Location | 3628387..3628943 | Replicon | chromosome |
| Accession | NZ_CP101527 | ||
| Organism | Alkalimarinus sediminis strain FA028 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | - |
| Locus tag | NNL22_RS16130 | Protein ID | WP_251813107.1 |
| Coordinates | 3628387..3628698 (-) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | - |
| Locus tag | NNL22_RS16135 | Protein ID | WP_251813108.1 |
| Coordinates | 3628686..3628943 (-) | Length | 86 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NNL22_RS16095 (NNL22_16080) | 3623548..3623979 | - | 432 | WP_251813114.1 | hypothetical protein | - |
| NNL22_RS16100 (NNL22_16085) | 3624110..3624532 | - | 423 | WP_251813113.1 | hypothetical protein | - |
| NNL22_RS16105 (NNL22_16090) | 3624658..3625215 | - | 558 | WP_267267784.1 | hypothetical protein | - |
| NNL22_RS16110 (NNL22_16095) | 3626033..3626464 | - | 432 | WP_251813103.1 | hypothetical protein | - |
| NNL22_RS16115 (NNL22_16100) | 3626592..3626870 | - | 279 | WP_251813104.1 | hypothetical protein | - |
| NNL22_RS16120 (NNL22_16105) | 3627033..3627401 | - | 369 | WP_251813105.1 | hypothetical protein | - |
| NNL22_RS16125 (NNL22_16110) | 3627475..3627972 | - | 498 | WP_251813106.1 | hypothetical protein | - |
| NNL22_RS16130 (NNL22_16115) | 3628387..3628698 | - | 312 | WP_251813107.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| NNL22_RS16135 (NNL22_16120) | 3628686..3628943 | - | 258 | WP_251813108.1 | type II toxin-antitoxin system prevent-host-death family antitoxin | Antitoxin |
| NNL22_RS16140 (NNL22_16125) | 3630804..3631247 | - | 444 | WP_251813117.1 | hypothetical protein | - |
| NNL22_RS16145 (NNL22_16130) | 3632120..3632575 | - | 456 | WP_251813118.1 | Imm26 family immunity protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Integron | - | - | 3622155..3640099 | 17944 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12146.79 Da Isoelectric Point: 4.5482
>T252206 WP_251813107.1 NZ_CP101527:c3628698-3628387 [Alkalimarinus sediminis]
MVQIIWTEPALDNLDDIAEYIAVSNPYAAKQLVENVFSKVQRLEQFPDSGRVPEEISNLNYRELVVNPCRVFYKVDRDSV
YILHVMRQERDLRKFLLSTENEN
MVQIIWTEPALDNLDDIAEYIAVSNPYAAKQLVENVFSKVQRLEQFPDSGRVPEEISNLNYRELVVNPCRVFYKVDRDSV
YILHVMRQERDLRKFLLSTENEN
Download Length: 312 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|