Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) /BrnT(toxin)
Location 1597928..1598414 Replicon chromosome
Accession NZ_CP101527
Organism Alkalimarinus sediminis strain FA028

Toxin (Protein)


Gene name - Uniprot ID -
Locus tag NNL22_RS07105 Protein ID WP_251812019.1
Coordinates 1598151..1598414 (-) Length 88 a.a.

Antitoxin (Protein)


Gene name - Uniprot ID -
Locus tag NNL22_RS07100 Protein ID WP_251812020.1
Coordinates 1597928..1598161 (-) Length 78 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NNL22_RS07060 (NNL22_07055) 1593355..1593891 - 537 WP_251812028.1 N-acetyltransferase -
NNL22_RS07065 (NNL22_07060) 1593968..1594180 - 213 WP_251812027.1 hypothetical protein -
NNL22_RS07070 (NNL22_07065) 1594318..1594719 - 402 WP_251812026.1 GFA family protein -
NNL22_RS07075 (NNL22_07070) 1594887..1595462 - 576 WP_251812025.1 YdeI/OmpD-associated family protein -
NNL22_RS07080 (NNL22_07075) 1595619..1595921 - 303 WP_251812024.1 hypothetical protein -
NNL22_RS07085 (NNL22_07080) 1596168..1596761 - 594 WP_251812023.1 hypothetical protein -
NNL22_RS07090 (NNL22_07085) 1597005..1597370 - 366 WP_251812022.1 hypothetical protein -
NNL22_RS07095 (NNL22_07090) 1597367..1597768 - 402 WP_251812021.1 hypothetical protein -
NNL22_RS07100 (NNL22_07095) 1597928..1598161 - 234 WP_251812020.1 BrnA antitoxin family protein Antitoxin
NNL22_RS07105 (NNL22_07100) 1598151..1598414 - 264 WP_251812019.1 BrnT family toxin Toxin
NNL22_RS07110 (NNL22_07105) 1598572..1598949 - 378 WP_251812018.1 hypothetical protein -
NNL22_RS07115 (NNL22_07110) 1599077..1599562 - 486 WP_251812017.1 DUF2004 domain-containing protein -
NNL22_RS07120 (NNL22_07115) 1600350..1600682 - 333 WP_251813131.1 hypothetical protein -
NNL22_RS07125 (NNL22_07120) 1600796..1601398 - 603 WP_267267841.1 DMP19 family protein -
NNL22_RS07130 (NNL22_07125) 1601424..1601759 - 336 WP_251813140.1 type II toxin-antitoxin system HicB family antitoxin -
NNL22_RS07135 (NNL22_07130) 1602404..1602553 - 150 WP_251813123.1 hypothetical protein -
NNL22_RS07140 (NNL22_07135) 1602528..1602878 - 351 WP_251813124.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Integron - - 1597367..1616609 19242


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Ribonuclease toxin, BrnT, of type II toxin-antitoxin system

(6-81)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 88 a.a.        Molecular weight: 10007.16 Da        Isoelectric Point: 6.4605

>T252205 WP_251812019.1 NZ_CP101527:c1598414-1598151 [Alkalimarinus sediminis]
MSDFEYDPQKSKSNLEKHGIDFEQAKCLWDDSNLVEISAKTTDEPRSLVIGQIGSKHWSAVITYRNSTIRIISVRRSRNT
EVSLYES

Download         Length: 264 bp

Antitoxin


Download         Length: 78 a.a.        Molecular weight: 9118.36 Da        Isoelectric Point: 6.2245

>AT252205 WP_251812020.1 NZ_CP101527:c1598161-1597928 [Alkalimarinus sediminis]
MKAKDFEEKFDANEEDLISNLDLSSVKRVNQQQKRVNVDFPVWMIESLDKEASRLGVTRQSIIKVWLAERLEHQIHH

Download         Length: 234 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References