Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/- |
Location | 890412..890998 | Replicon | plasmid pla_2 |
Accession | NZ_CP101526 | ||
Organism | Burkholderia arboris strain MEC_B345 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | NLX30_RS37700 | Protein ID | WP_256087419.1 |
Coordinates | 890412..890795 (-) | Length | 128 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | - |
Locus tag | NLX30_RS37705 | Protein ID | WP_174993891.1 |
Coordinates | 890792..890998 (-) | Length | 69 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NLX30_RS37690 (NLX30_37620) | 886732..888387 | - | 1656 | WP_256087417.1 | tail fiber protein | - |
NLX30_RS37695 (NLX30_37625) | 889438..890013 | + | 576 | WP_256087418.1 | hypothetical protein | - |
NLX30_RS37700 (NLX30_37630) | 890412..890795 | - | 384 | WP_256087419.1 | PIN domain-containing protein | Toxin |
NLX30_RS37705 (NLX30_37635) | 890792..890998 | - | 207 | WP_174993891.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
NLX30_RS37710 (NLX30_37640) | 891443..893311 | + | 1869 | WP_256087825.1 | RNA polymerase sigma factor RpoD | - |
NLX30_RS37715 (NLX30_37645) | 893710..894201 | - | 492 | Protein_709 | ISNCY family transposase | - |
NLX30_RS37720 (NLX30_37650) | 895033..895728 | + | 696 | WP_155627346.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | - | 1..1260712 | 1260712 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 128 a.a. Molecular weight: 14345.67 Da Isoelectric Point: 7.2933
>T252202 WP_256087419.1 NZ_CP101526:c890795-890412 [Burkholderia arboris]
MSVLVDTSVWVEHFRRPLPALIQLLRIDNVLTHPLVILELTCGTPPEPRARTLGDLALLRQTRLATSGEVADWIERERLY
GRGCGAVDCTLLASVLLTPSTRLWTRDRRLTQLAEQFGVHYVPPDLH
MSVLVDTSVWVEHFRRPLPALIQLLRIDNVLTHPLVILELTCGTPPEPRARTLGDLALLRQTRLATSGEVADWIERERLY
GRGCGAVDCTLLASVLLTPSTRLWTRDRRLTQLAEQFGVHYVPPDLH
Download Length: 384 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|