Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/- |
| Location | 2329710..2330296 | Replicon | plasmid pla_1 |
| Accession | NZ_CP101525 | ||
| Organism | Burkholderia arboris strain MEC_B345 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | NLX30_RS28940 | Protein ID | WP_234743364.1 |
| Coordinates | 2329913..2330296 (+) | Length | 128 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | - |
| Locus tag | NLX30_RS28935 | Protein ID | WP_234743363.1 |
| Coordinates | 2329710..2329916 (+) | Length | 69 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NLX30_RS28910 (NLX30_28865) | 2325028..2325861 | - | 834 | WP_212103873.1 | DUF1295 domain-containing protein | - |
| NLX30_RS28915 (NLX30_28870) | 2326013..2326747 | - | 735 | WP_059676247.1 | anti-sigma factor | - |
| NLX30_RS28920 (NLX30_28875) | 2326744..2327355 | - | 612 | WP_034203526.1 | sigma-70 family RNA polymerase sigma factor | - |
| NLX30_RS28925 (NLX30_28880) | 2327606..2328175 | + | 570 | WP_212103891.1 | lipocalin family protein | - |
| NLX30_RS28930 (NLX30_28885) | 2328466..2329125 | - | 660 | WP_059676244.1 | carbonic anhydrase | - |
| NLX30_RS28935 (NLX30_28890) | 2329710..2329916 | + | 207 | WP_234743363.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| NLX30_RS28940 (NLX30_28895) | 2329913..2330296 | + | 384 | WP_234743364.1 | PIN domain-containing protein | Toxin |
| NLX30_RS28945 (NLX30_28900) | 2330340..2330591 | + | 252 | WP_234743365.1 | hypothetical protein | - |
| NLX30_RS28950 (NLX30_28905) | 2330588..2330791 | - | 204 | Protein_2124 | transposase domain-containing protein | - |
| NLX30_RS28955 (NLX30_28910) | 2331409..2332281 | - | 873 | WP_027792660.1 | slipin family protein | - |
| NLX30_RS28960 (NLX30_28915) | 2332609..2333061 | + | 453 | WP_011548845.1 | type II toxin-antitoxin system HicB family antitoxin | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | htpB / adeG / pchB / pchD / pmlI/bspI1 / pmlR/bspR1 / hsiC1/vipB / flgE / gnd | 1..3525317 | 3525317 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 128 a.a. Molecular weight: 14289.65 Da Isoelectric Point: 7.7835
>T252201 WP_234743364.1 NZ_CP101525:2329913-2330296 [Burkholderia arboris]
MSVLVDTSVWVEHFRRPLPALIQLLRVDSILTHPLVILELTCGTPPEPRARTLGDLALLRQTRLATPGEVADWIERERLY
GRGCGAVDCTLLASVLLTPSTRLWTRDRRLAQLAERFGAQYVPPDLH
MSVLVDTSVWVEHFRRPLPALIQLLRVDSILTHPLVILELTCGTPPEPRARTLGDLALLRQTRLATPGEVADWIERERLY
GRGCGAVDCTLLASVLLTPSTRLWTRDRRLAQLAERFGAQYVPPDLH
Download Length: 384 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|