Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-StbC |
| Location | 1980297..1980952 | Replicon | plasmid pla_1 |
| Accession | NZ_CP101525 | ||
| Organism | Burkholderia arboris strain MEC_B345 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | NLX30_RS27385 | Protein ID | WP_059239811.1 |
| Coordinates | 1980533..1980952 (+) | Length | 140 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | - |
| Locus tag | NLX30_RS27380 | Protein ID | WP_256087293.1 |
| Coordinates | 1980297..1980536 (+) | Length | 80 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NLX30_RS27355 (NLX30_27310) | 1975568..1975963 | - | 396 | WP_174991368.1 | type II toxin-antitoxin system VapC family toxin | - |
| NLX30_RS27360 (NLX30_27315) | 1975960..1976199 | - | 240 | WP_059239804.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | - |
| NLX30_RS27365 (NLX30_27320) | 1976291..1976974 | - | 684 | WP_256086128.1 | Fe2+-dependent dioxygenase | - |
| NLX30_RS27370 (NLX30_27325) | 1976971..1977726 | - | 756 | WP_059239808.1 | tetratricopeptide repeat protein | - |
| NLX30_RS27375 (NLX30_27330) | 1977730..1979973 | - | 2244 | WP_256086129.1 | TonB-dependent siderophore receptor | - |
| NLX30_RS27380 (NLX30_27335) | 1980297..1980536 | + | 240 | WP_256087293.1 | Arc family DNA-binding protein | Antitoxin |
| NLX30_RS27385 (NLX30_27340) | 1980533..1980952 | + | 420 | WP_059239811.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| NLX30_RS27390 (NLX30_27345) | 1981082..1982377 | - | 1296 | WP_059239813.1 | aspartate carbamoyltransferase | - |
| NLX30_RS27395 (NLX30_27350) | 1982612..1982746 | + | 135 | WP_021158165.1 | entericidin A/B family lipoprotein | - |
| NLX30_RS27400 (NLX30_27355) | 1982842..1983390 | - | 549 | WP_256086130.1 | permease | - |
| NLX30_RS27405 (NLX30_27360) | 1983589..1984557 | - | 969 | WP_256086131.1 | DMT family transporter | - |
| NLX30_RS27410 (NLX30_27365) | 1984724..1985518 | - | 795 | WP_256086132.1 | AraC family transcriptional regulator | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | htpB / adeG / pchB / pchD / pmlI/bspI1 / pmlR/bspR1 / hsiC1/vipB / flgE / gnd | 1..3525317 | 3525317 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 140 a.a. Molecular weight: 15058.33 Da Isoelectric Point: 5.7457
>T252199 WP_059239811.1 NZ_CP101525:1980533-1980952 [Burkholderia arboris]
MILVDTNVMSEPLRREPSAAVIEWLDAQNVETLFLSAISLAELRFGVAGLPEGRRRDWLHQGIEQRVVPLFRGRILPFDD
AASKAYASLCARARAAGTALAVVDGHIAATAEANGLIVATRDVAPFEAVGLRVIDPWAR
MILVDTNVMSEPLRREPSAAVIEWLDAQNVETLFLSAISLAELRFGVAGLPEGRRRDWLHQGIEQRVVPLFRGRILPFDD
AASKAYASLCARARAAGTALAVVDGHIAATAEANGLIVATRDVAPFEAVGLRVIDPWAR
Download Length: 420 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|