Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/VapC-StbC
Location 1980297..1980952 Replicon plasmid pla_1
Accession NZ_CP101525
Organism Burkholderia arboris strain MEC_B345

Toxin (Protein)


Gene name vapC Uniprot ID -
Locus tag NLX30_RS27385 Protein ID WP_059239811.1
Coordinates 1980533..1980952 (+) Length 140 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID -
Locus tag NLX30_RS27380 Protein ID WP_256087293.1
Coordinates 1980297..1980536 (+) Length 80 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NLX30_RS27355 (NLX30_27310) 1975568..1975963 - 396 WP_174991368.1 type II toxin-antitoxin system VapC family toxin -
NLX30_RS27360 (NLX30_27315) 1975960..1976199 - 240 WP_059239804.1 type II toxin-antitoxin system Phd/YefM family antitoxin -
NLX30_RS27365 (NLX30_27320) 1976291..1976974 - 684 WP_256086128.1 Fe2+-dependent dioxygenase -
NLX30_RS27370 (NLX30_27325) 1976971..1977726 - 756 WP_059239808.1 tetratricopeptide repeat protein -
NLX30_RS27375 (NLX30_27330) 1977730..1979973 - 2244 WP_256086129.1 TonB-dependent siderophore receptor -
NLX30_RS27380 (NLX30_27335) 1980297..1980536 + 240 WP_256087293.1 Arc family DNA-binding protein Antitoxin
NLX30_RS27385 (NLX30_27340) 1980533..1980952 + 420 WP_059239811.1 type II toxin-antitoxin system VapC family toxin Toxin
NLX30_RS27390 (NLX30_27345) 1981082..1982377 - 1296 WP_059239813.1 aspartate carbamoyltransferase -
NLX30_RS27395 (NLX30_27350) 1982612..1982746 + 135 WP_021158165.1 entericidin A/B family lipoprotein -
NLX30_RS27400 (NLX30_27355) 1982842..1983390 - 549 WP_256086130.1 permease -
NLX30_RS27405 (NLX30_27360) 1983589..1984557 - 969 WP_256086131.1 DMT family transporter -
NLX30_RS27410 (NLX30_27365) 1984724..1985518 - 795 WP_256086132.1 AraC family transcriptional regulator -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - htpB / adeG / pchB / pchD / pmlI/bspI1 / pmlR/bspR1 / hsiC1/vipB / flgE / gnd 1..3525317 3525317


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(2-122)

Antitoxin

Arc-like DNA binding domain

(5-46)


Sequences

Toxin        


Download         Length: 140 a.a.        Molecular weight: 15058.33 Da        Isoelectric Point: 5.7457

>T252199 WP_059239811.1 NZ_CP101525:1980533-1980952 [Burkholderia arboris]
MILVDTNVMSEPLRREPSAAVIEWLDAQNVETLFLSAISLAELRFGVAGLPEGRRRDWLHQGIEQRVVPLFRGRILPFDD
AASKAYASLCARARAAGTALAVVDGHIAATAEANGLIVATRDVAPFEAVGLRVIDPWAR

Download         Length: 420 bp

Antitoxin


Download         Length: 80 a.a.        Molecular weight: 8614.85 Da        Isoelectric Point: 7.2055

>AT252199 WP_256087293.1 NZ_CP101525:1980297-1980536 [Burkholderia arboris]
MPAITVRNLPDEVHRALRIRAARHGRSTEAEVRDILEQAVLPGGRLKLGTLLAEIGRAAGDADFSVPRDKTPTEPMGFE

Download         Length: 240 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References