Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relE-PumB/upstrm_HI1419-dnstrm_HI1420 |
| Location | 73509..74150 | Replicon | plasmid pla_1 |
| Accession | NZ_CP101525 | ||
| Organism | Burkholderia arboris strain MEC_B345 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | - |
| Locus tag | NLX30_RS18615 | Protein ID | WP_059237391.1 |
| Coordinates | 73509..73847 (+) | Length | 113 a.a. |
Antitoxin (Protein)
| Gene name | PumB | Uniprot ID | - |
| Locus tag | NLX30_RS18620 | Protein ID | WP_256086647.1 |
| Coordinates | 73851..74150 (+) | Length | 100 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NLX30_RS18605 (NLX30_18575) | 70060..71493 | - | 1434 | WP_256086646.1 | aldehyde dehydrogenase family protein | - |
| NLX30_RS18610 (NLX30_18580) | 71523..73163 | - | 1641 | WP_174993107.1 | acetolactate synthase large subunit | - |
| NLX30_RS18615 (NLX30_18585) | 73509..73847 | + | 339 | WP_059237391.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| NLX30_RS18620 (NLX30_18590) | 73851..74150 | + | 300 | WP_256086647.1 | putative addiction module antidote protein | Antitoxin |
| NLX30_RS18625 (NLX30_18595) | 74200..75486 | - | 1287 | WP_256086648.1 | DUF445 domain-containing protein | - |
| NLX30_RS18630 (NLX30_18600) | 75594..76814 | - | 1221 | WP_256086649.1 | anthranilate 1,2-dioxygenase system ferredoxin--NAD(+) reductase | - |
| NLX30_RS18635 (NLX30_18605) | 76804..77130 | - | 327 | WP_059237394.1 | anthranilate 1,2-dioxygenase ferredoxin subunit AndAb | - |
| NLX30_RS18640 (NLX30_18610) | 77148..77624 | - | 477 | WP_175841486.1 | anthranilate 1,2-dioxygenase small subunit AndAd | - |
| NLX30_RS18645 (NLX30_18615) | 77639..78910 | - | 1272 | WP_059240780.1 | anthranilate 1,2-dioxygenase large subunit AndAc | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | htpB / adeG / pchB / pchD / pmlI/bspI1 / pmlR/bspR1 / hsiC1/vipB / flgE / gnd | 1..3525317 | 3525317 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 113 a.a. Molecular weight: 12623.54 Da Isoelectric Point: 9.9829
>T252198 WP_059237391.1 NZ_CP101525:73509-73847 [Burkholderia arboris]
MVDILQSVPYSAPTFSVRTTAVFDAWFAGLSDRIARRRIQARIDRLSMGNPGDWKSAGSPIVEMRIDHGPGYRVYYVRRG
MRWVILLCGGDKSTQQADIRAAHAMLAHLDME
MVDILQSVPYSAPTFSVRTTAVFDAWFAGLSDRIARRRIQARIDRLSMGNPGDWKSAGSPIVEMRIDHGPGYRVYYVRRG
MRWVILLCGGDKSTQQADIRAAHAMLAHLDME
Download Length: 339 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|