Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vagCD/VapC-VagC |
| Location | 1965705..1966381 | Replicon | chromosome |
| Accession | NZ_CP101524 | ||
| Organism | Burkholderia arboris strain MEC_B345 | ||
Toxin (Protein)
| Gene name | vagD | Uniprot ID | - |
| Locus tag | NLX30_RS09570 | Protein ID | WP_256084842.1 |
| Coordinates | 1965965..1966381 (+) | Length | 139 a.a. |
Antitoxin (Protein)
| Gene name | vagC | Uniprot ID | - |
| Locus tag | NLX30_RS09565 | Protein ID | WP_256084841.1 |
| Coordinates | 1965705..1965968 (+) | Length | 88 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NLX30_RS09550 (NLX30_09545) | 1961248..1963512 | + | 2265 | WP_174991472.1 | TonB-dependent siderophore receptor | - |
| NLX30_RS09555 (NLX30_09550) | 1963599..1964438 | + | 840 | WP_059234249.1 | N(5)-hydroxyornithine transformylase PvdF | - |
| NLX30_RS09560 (NLX30_09555) | 1964438..1965454 | + | 1017 | WP_256084840.1 | GNAT family N-acetyltransferase | - |
| NLX30_RS09565 (NLX30_09560) | 1965705..1965968 | + | 264 | WP_256084841.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| NLX30_RS09570 (NLX30_09565) | 1965965..1966381 | + | 417 | WP_256084842.1 | PIN domain-containing protein | Toxin |
| NLX30_RS09575 (NLX30_09570) | 1966558..1967721 | + | 1164 | WP_174991477.1 | M20 aminoacylase family protein | - |
| NLX30_RS09580 (NLX30_09575) | 1967887..1968426 | + | 540 | WP_256084843.1 | outer membrane protein assembly factor BamE | - |
| NLX30_RS09585 (NLX30_09580) | 1968453..1969757 | - | 1305 | WP_256084844.1 | cobyrinate a,c-diamide synthase | - |
| NLX30_RS09590 (NLX30_09585) | 1969760..1970362 | - | 603 | WP_059234234.1 | cob(I)yrinic acid a,c-diamide adenosyltransferase | - |
| NLX30_RS09595 (NLX30_09590) | 1970397..1970774 | - | 378 | WP_059234232.1 | cobalamin biosynthesis protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 14499.68 Da Isoelectric Point: 8.5418
>T252197 WP_256084842.1 NZ_CP101524:1965965-1966381 [Burkholderia arboris]
VTTLYMLDTNICSFIMRERPPVVLSRLQSCVNAQHRIVVSAITYAEMRFGAVGKKASPKHAELVTAFVSRLDGVLPWDTA
AVDATAAIRADLAARGTPIGTNDASIAGHAIAAGAVLVSHNGRAFGRVAGLSLEDWAA
VTTLYMLDTNICSFIMRERPPVVLSRLQSCVNAQHRIVVSAITYAEMRFGAVGKKASPKHAELVTAFVSRLDGVLPWDTA
AVDATAAIRADLAARGTPIGTNDASIAGHAIAAGAVLVSHNGRAFGRVAGLSLEDWAA
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|