Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapC-vagC/VapC-VagC |
| Location | 154457..155094 | Replicon | chromosome |
| Accession | NZ_CP101524 | ||
| Organism | Burkholderia arboris strain MEC_B345 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | NLX30_RS00690 | Protein ID | WP_256085429.1 |
| Coordinates | 154693..155094 (+) | Length | 134 a.a. |
Antitoxin (Protein)
| Gene name | vagC | Uniprot ID | - |
| Locus tag | NLX30_RS00685 | Protein ID | WP_059236527.1 |
| Coordinates | 154457..154693 (+) | Length | 79 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NLX30_RS00670 (NLX30_00670) | 150173..151207 | + | 1035 | WP_059232772.1 | helix-turn-helix domain-containing protein | - |
| NLX30_RS00675 (NLX30_00675) | 151298..152404 | - | 1107 | WP_256086028.1 | ADP-heptose--LPS heptosyltransferase | - |
| NLX30_RS00680 (NLX30_00680) | 152401..154104 | - | 1704 | WP_256085428.1 | thiamine pyrophosphate-binding protein | - |
| NLX30_RS00685 (NLX30_00685) | 154457..154693 | + | 237 | WP_059236527.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| NLX30_RS00690 (NLX30_00690) | 154693..155094 | + | 402 | WP_256085429.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| NLX30_RS00695 (NLX30_00695) | 155164..156552 | - | 1389 | WP_059232769.1 | L-serine ammonia-lyase | - |
| NLX30_RS00700 (NLX30_00700) | 156583..157725 | - | 1143 | WP_256085430.1 | alginate lyase family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 134 a.a. Molecular weight: 14964.06 Da Isoelectric Point: 5.6634
>T252196 WP_256085429.1 NZ_CP101524:154693-155094 [Burkholderia arboris]
MPRYMLDTNMCIYLIKNQPEQVARRFAQCYSGDVVMSAITHAELEYGVAACANPVRERRNLAALIEDIPVAPFDTAAAQA
YGPVREATRERKKDHLDKLIAAHAVSLDVVLVTNNERDFASYPGLRLENWLND
MPRYMLDTNMCIYLIKNQPEQVARRFAQCYSGDVVMSAITHAELEYGVAACANPVRERRNLAALIEDIPVAPFDTAAAQA
YGPVREATRERKKDHLDKLIAAHAVSLDVVLVTNNERDFASYPGLRLENWLND
Download Length: 402 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|