Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/UPF0150(antitoxin) |
| Location | 2436127..2436765 | Replicon | chromosome |
| Accession | NZ_CP101513 | ||
| Organism | Escherichia coli strain HH194M | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | S1F9G9 |
| Locus tag | MOO21_RS11780 | Protein ID | WP_000813794.1 |
| Coordinates | 2436589..2436765 (-) | Length | 59 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | - |
| Locus tag | MOO21_RS11775 | Protein ID | WP_001270286.1 |
| Coordinates | 2436127..2436543 (-) | Length | 139 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| MOO21_RS11755 (2431279) | 2431279..2432220 | - | 942 | WP_001251319.1 | ABC transporter permease | - |
| MOO21_RS11760 (2432221) | 2432221..2433234 | - | 1014 | WP_247193865.1 | ABC transporter ATP-binding protein | - |
| MOO21_RS11765 (2433252) | 2433252..2434397 | - | 1146 | WP_000047429.1 | ABC transporter substrate-binding protein | - |
| MOO21_RS11770 (2434639) | 2434639..2436048 | - | 1410 | WP_000760625.1 | PLP-dependent aminotransferase family protein | - |
| MOO21_RS11775 (2436127) | 2436127..2436543 | - | 417 | WP_001270286.1 | type II toxin-antitoxin system antitoxin HicB | Antitoxin |
| MOO21_RS11780 (2436589) | 2436589..2436765 | - | 177 | WP_000813794.1 | type II toxin-antitoxin system mRNA interferase toxin HicA | Toxin |
| MOO21_RS11785 (2436987) | 2436987..2437217 | + | 231 | WP_000494244.1 | YncJ family protein | - |
| MOO21_RS11790 (2437309) | 2437309..2439270 | - | 1962 | WP_001303492.1 | 23S rRNA 5-hydroxycytidine C2501 synthase | - |
| MOO21_RS11795 (2439343) | 2439343..2439879 | - | 537 | WP_000429155.1 | DNA-binding transcriptional regulator SutR | - |
| MOO21_RS11800 (2439971) | 2439971..2441146 | + | 1176 | WP_001236265.1 | BenE family transporter YdcO | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6749.83 Da Isoelectric Point: 11.2298
>T252175 WP_000813794.1 NZ_CP101513:c2436765-2436589 [Escherichia coli]
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
Download Length: 177 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15246.63 Da Isoelectric Point: 4.7386
>AT252175 WP_001270286.1 NZ_CP101513:c2436543-2436127 [Escherichia coli]
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|