Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
Location | 543719..544355 | Replicon | chromosome |
Accession | NZ_CP101506 | ||
Organism | Bacillus altitudinis strain B12 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | K2MHT4 |
Locus tag | NM966_RS02675 | Protein ID | WP_003214169.1 |
Coordinates | 544005..544355 (+) | Length | 117 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | W8QJ31 |
Locus tag | NM966_RS02670 | Protein ID | WP_003214273.1 |
Coordinates | 543719..544000 (+) | Length | 94 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NM966_RS02650 (NM966_02645) | 539871..540476 | - | 606 | WP_007496491.1 | rhomboid family intramembrane serine protease | - |
NM966_RS02655 (NM966_02650) | 540573..540938 | + | 366 | WP_144610494.1 | holo-ACP synthase | - |
NM966_RS02660 (NM966_02655) | 541099..542115 | + | 1017 | WP_007496489.1 | outer membrane lipoprotein-sorting protein | - |
NM966_RS02665 (NM966_02660) | 542244..543425 | + | 1182 | WP_017366664.1 | alanine racemase | - |
NM966_RS02670 (NM966_02665) | 543719..544000 | + | 282 | WP_003214273.1 | hypothetical protein | Antitoxin |
NM966_RS02675 (NM966_02670) | 544005..544355 | + | 351 | WP_003214169.1 | type II toxin-antitoxin system endoribonuclease NdoA | Toxin |
NM966_RS02680 (NM966_02675) | 544470..545300 | + | 831 | WP_007496484.1 | RsbT co-antagonist protein RsbRA | - |
NM966_RS02685 (NM966_02680) | 545305..545673 | + | 369 | WP_003214235.1 | RsbT antagonist protein RsbS | - |
NM966_RS02690 (NM966_02685) | 545676..546077 | + | 402 | WP_003214085.1 | anti-sigma regulatory factor | - |
NM966_RS02695 (NM966_02690) | 546088..547095 | + | 1008 | WP_017358394.1 | PP2C family protein-serine/threonine phosphatase | - |
NM966_RS02700 (NM966_02695) | 547155..547484 | + | 330 | WP_017358393.1 | anti-sigma factor antagonist | - |
NM966_RS02705 (NM966_02700) | 547481..547969 | + | 489 | WP_048001251.1 | anti-sigma B factor RsbW | - |
NM966_RS02710 (NM966_02705) | 547935..548723 | + | 789 | WP_012009000.1 | RNA polymerase sigma factor SigB | - |
NM966_RS02715 (NM966_02710) | 548723..549322 | + | 600 | WP_008346897.1 | PP2C family serine/threonine-protein phosphatase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12976.99 Da Isoelectric Point: 5.1663
>T252162 WP_003214169.1 NZ_CP101506:544005-544355 [Bacillus altitudinis]
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEINAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMEKVDEALQVSLALIDF
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEINAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMEKVDEALQVSLALIDF
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | K2MHT4 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A081L854 |