Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/VapC(toxin)
Location 2212742..2213373 Replicon chromosome
Accession NZ_CP101497
Organism Microcella sp. MMS21-STM10

Toxin (Protein)


Gene name vapC Uniprot ID -
Locus tag NNL39_RS10790 Protein ID WP_255159280.1
Coordinates 2212742..2213152 (-) Length 137 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID -
Locus tag NNL39_RS10795 Protein ID WP_255159281.1
Coordinates 2213143..2213373 (-) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NNL39_RS10760 (NNL39_10760) 2207921..2208547 - 627 WP_255159274.1 TetR/AcrR family transcriptional regulator -
NNL39_RS10765 (NNL39_10765) 2208635..2209288 + 654 WP_255159275.1 hypothetical protein -
NNL39_RS10770 (NNL39_10770) 2209326..2209892 - 567 WP_255159276.1 LysR substrate-binding domain-containing protein -
NNL39_RS10775 (NNL39_10775) 2209947..2210408 + 462 WP_255159277.1 DUF5997 family protein -
NNL39_RS10780 (NNL39_10780) 2210405..2211379 - 975 WP_255159278.1 FUSC family protein -
NNL39_RS10785 (NNL39_10785) 2211453..2212688 + 1236 WP_255159279.1 amidohydrolase -
NNL39_RS10790 (NNL39_10790) 2212742..2213152 - 411 WP_255159280.1 PIN domain nuclease Toxin
NNL39_RS10795 (NNL39_10795) 2213143..2213373 - 231 WP_255159281.1 hypothetical protein Antitoxin
NNL39_RS10800 (NNL39_10800) 2213421..2214374 - 954 WP_255159282.1 lysylphosphatidylglycerol synthase transmembrane domain-containing protein -
NNL39_RS10805 (NNL39_10805) 2214356..2215102 - 747 WP_255159283.1 CDP-alcohol phosphatidyltransferase family protein -
NNL39_RS10810 (NNL39_10810) 2215107..2215667 - 561 WP_255159284.1 peptide-methionine (S)-S-oxide reductase MsrA -
NNL39_RS10815 (NNL39_10815) 2215664..2216119 - 456 WP_255159285.1 peptide-methionine (R)-S-oxide reductase MsrB -
NNL39_RS10820 (NNL39_10820) 2216240..2217163 - 924 WP_255159286.1 DMT family transporter -
NNL39_RS10825 (NNL39_10825) 2217232..2217690 + 459 WP_255159287.1 HNH endonuclease signature motif containing protein -
NNL39_RS10830 (NNL39_10830) 2217574..2217930 - 357 WP_255159288.1 PIN domain-containing protein -
NNL39_RS10835 (NNL39_10835) 2217933..2218193 - 261 WP_255159289.1 AbrB/MazE/SpoVT family DNA-binding domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(8-125)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 137 a.a.        Molecular weight: 14838.11 Da        Isoelectric Point: 4.7238

>T252161 WP_255159280.1 NZ_CP101497:c2213152-2212742 [Microcella sp. MMS21-STM10]
VAVTPWLIDKSAYVRLADSPDAELWLTRIARGLVRITGITQLEIGYSMRSAEQSRLEFASPPLSLLPVEHLTPGIERRAL
EVQQLLGDRGQHRAPSIPDLLIAATAELTGCTVLAVDKDFDLVAEVTGQAIERLAL

Download         Length: 411 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8593.59 Da        Isoelectric Point: 4.4734

>AT252161 WP_255159281.1 NZ_CP101497:c2213373-2213143 [Microcella sp. MMS21-STM10]
MTDILIRGMSDESVARIEEQASRLGLSRNEYLRRQLDALADVQREAPAEISLDDLRRASHAARDLDDPDVMAAAWR

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References