Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/PHD(antitoxin) |
| Location | 1664198..1664881 | Replicon | chromosome |
| Accession | NZ_CP101497 | ||
| Organism | Microcella sp. MMS21-STM10 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | NNL39_RS08080 | Protein ID | WP_255158702.1 |
| Coordinates | 1664495..1664881 (+) | Length | 129 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | - |
| Locus tag | NNL39_RS08075 | Protein ID | WP_255158701.1 |
| Coordinates | 1664198..1664494 (+) | Length | 99 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NNL39_RS08065 (NNL39_08065) | 1661351..1662334 | + | 984 | WP_255158698.1 | ribonucleotide-diphosphate reductase subunit beta | - |
| NNL39_RS08070 (NNL39_08070) | 1662377..1664146 | + | 1770 | WP_255158700.1 | amidohydrolase | - |
| NNL39_RS08075 (NNL39_08075) | 1664198..1664494 | + | 297 | WP_255158701.1 | type II toxin-antitoxin system prevent-host-death family antitoxin | Antitoxin |
| NNL39_RS08080 (NNL39_08080) | 1664495..1664881 | + | 387 | WP_255158702.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| NNL39_RS08085 (NNL39_08085) | 1664911..1665882 | + | 972 | WP_255158703.1 | acyl-CoA thioesterase | - |
| NNL39_RS08090 (NNL39_08090) | 1665952..1667037 | + | 1086 | WP_255158704.1 | hypothetical protein | - |
| NNL39_RS08095 (NNL39_08095) | 1667061..1667294 | - | 234 | WP_255158705.1 | DUF3418 domain-containing protein | - |
| NNL39_RS08100 (NNL39_08100) | 1667293..1668921 | + | 1629 | WP_255158707.1 | CDP-alcohol phosphatidyltransferase | - |
| NNL39_RS08105 (NNL39_08105) | 1668905..1669315 | - | 411 | WP_255158709.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 129 a.a. Molecular weight: 13712.75 Da Isoelectric Point: 4.6647
>T252160 WP_255158702.1 NZ_CP101497:1664495-1664881 [Microcella sp. MMS21-STM10]
VLYLDTSAAVKLLIEEKESSALRAYLSHHDWASSALVRTELVRALLRADPSVVPRALDLLAQGNLLVIDTQVLDTAARLS
PPSLRSLDAIHLASALELRDELTAFVAYDERLLAAASALGMPVASPAD
VLYLDTSAAVKLLIEEKESSALRAYLSHHDWASSALVRTELVRALLRADPSVVPRALDLLAQGNLLVIDTQVLDTAARLS
PPSLRSLDAIHLASALELRDELTAFVAYDERLLAAASALGMPVASPAD
Download Length: 387 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|