Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VapB |
Location | 388165..388731 | Replicon | chromosome |
Accession | NZ_CP101497 | ||
Organism | Microcella sp. MMS21-STM10 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | NNL39_RS01850 | Protein ID | WP_255160862.1 |
Coordinates | 388165..388530 (-) | Length | 122 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | - |
Locus tag | NNL39_RS01855 | Protein ID | WP_255160012.1 |
Coordinates | 388537..388731 (-) | Length | 65 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NNL39_RS01820 (NNL39_01820) | 384610..385926 | + | 1317 | WP_255160006.1 | FAD-dependent oxidoreductase | - |
NNL39_RS01825 (NNL39_01825) | 385960..386382 | - | 423 | WP_255160007.1 | DUF1761 domain-containing protein | - |
NNL39_RS01830 (NNL39_01830) | 386459..387034 | + | 576 | WP_255160008.1 | 1-acyl-sn-glycerol-3-phosphate acyltransferase | - |
NNL39_RS01835 (NNL39_01835) | 387048..387470 | + | 423 | WP_255160009.1 | hypothetical protein | - |
NNL39_RS01840 (NNL39_01840) | 387514..387771 | - | 258 | WP_255160010.1 | DUF4190 domain-containing protein | - |
NNL39_RS01845 (NNL39_01845) | 387916..388134 | + | 219 | WP_255160011.1 | amphi-Trp domain-containing protein | - |
NNL39_RS01850 (NNL39_01850) | 388165..388530 | - | 366 | WP_255160862.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
NNL39_RS01855 (NNL39_01855) | 388537..388731 | - | 195 | WP_255160012.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
NNL39_RS01860 (NNL39_01860) | 389121..390194 | - | 1074 | WP_255160013.1 | redox-regulated ATPase YchF | - |
NNL39_RS01865 (NNL39_01865) | 390285..392102 | + | 1818 | WP_255160014.1 | gamma-glutamyltransferase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 122 a.a. Molecular weight: 13100.15 Da Isoelectric Point: 7.0741
>T252159 WP_255160862.1 NZ_CP101497:c388530-388165 [Microcella sp. MMS21-STM10]
MLVDTSVWIDHLHRGERELVRALNTSLVVQHPMVIGELSLGRLRDRSVVLELLGNLPSSPIASHSEVAGFVEVHALYGQG
LSLVDAHLLASVVLAPGTTLWTRDKRLREAANRLGVGASLP
MLVDTSVWIDHLHRGERELVRALNTSLVVQHPMVIGELSLGRLRDRSVVLELLGNLPSSPIASHSEVAGFVEVHALYGQG
LSLVDAHLLASVVLAPGTTLWTRDKRLREAANRLGVGASLP
Download Length: 366 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|