Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | PumA-relB/upstrm_HI1419-dnstrm_HI1420 |
| Location | 41677..42274 | Replicon | chromosome |
| Accession | NZ_CP101497 | ||
| Organism | Microcella sp. MMS21-STM10 | ||
Toxin (Protein)
| Gene name | PumA | Uniprot ID | - |
| Locus tag | NNL39_RS00200 | Protein ID | WP_255159712.1 |
| Coordinates | 41963..42274 (-) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | - |
| Locus tag | NNL39_RS00195 | Protein ID | WP_255159711.1 |
| Coordinates | 41677..41973 (-) | Length | 99 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NNL39_RS00165 (NNL39_00165) | 38359..38565 | + | 207 | WP_255159706.1 | dodecin family protein | - |
| NNL39_RS00170 (NNL39_00170) | 38562..38735 | - | 174 | WP_255159707.1 | hypothetical protein | - |
| NNL39_RS00175 (NNL39_00175) | 38832..39275 | - | 444 | WP_255159708.1 | hypothetical protein | - |
| NNL39_RS00180 (NNL39_00180) | 39405..40316 | + | 912 | WP_255159709.1 | M48 family metallopeptidase | - |
| NNL39_RS00185 (NNL39_00185) | 40334..40972 | - | 639 | WP_255159710.1 | phenylalanine--tRNA ligase beta subunit-related protein | - |
| NNL39_RS00190 (NNL39_00190) | 40979..41590 | - | 612 | WP_255160962.1 | LysE family translocator | - |
| NNL39_RS00195 (NNL39_00195) | 41677..41973 | - | 297 | WP_255159711.1 | putative addiction module antidote protein | Antitoxin |
| NNL39_RS00200 (NNL39_00200) | 41963..42274 | - | 312 | WP_255159712.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| NNL39_RS00205 (NNL39_00205) | 42447..43460 | + | 1014 | WP_255159713.1 | hypothetical protein | - |
| NNL39_RS00210 (NNL39_00210) | 43457..44143 | - | 687 | WP_255159714.1 | vWA domain-containing protein | - |
| NNL39_RS00215 (NNL39_00215) | 44140..45648 | - | 1509 | WP_255159715.1 | ADP-ribosylglycohydrolase family protein | - |
| NNL39_RS00220 (NNL39_00220) | 45802..46713 | - | 912 | WP_255159716.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 40979..53988 | 13009 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 11719.31 Da Isoelectric Point: 10.5104
>T252157 WP_255159712.1 NZ_CP101497:c42274-41963 [Microcella sp. MMS21-STM10]
MYELRRSAEFDRWLARLSDRGAVARVLVRLDRLARGNPGDVRPVGFGVSELRIDHGPGLRVYYLQHGGAIVLLLCGGDKS
TQSRDIRRAHRVAEQWRGEKHDD
MYELRRSAEFDRWLARLSDRGAVARVLVRLDRLARGNPGDVRPVGFGVSELRIDHGPGLRVYYLQHGGAIVLLLCGGDKS
TQSRDIRRAHRVAEQWRGEKHDD
Download Length: 312 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|