Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
Location | 932834..933363 | Replicon | chromosome |
Accession | NZ_CP101472 | ||
Organism | Staphylococcus equorum strain DX2 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | K7S376 |
Locus tag | NMQ06_RS04405 | Protein ID | WP_002511418.1 |
Coordinates | 933001..933363 (+) | Length | 121 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | J9GY23 |
Locus tag | NMQ06_RS04400 | Protein ID | WP_002507108.1 |
Coordinates | 932834..933004 (+) | Length | 57 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NMQ06_RS04375 (NMQ06_04370) | 928585..929064 | + | 480 | WP_021339947.1 | PH domain-containing protein | - |
NMQ06_RS04380 (NMQ06_04375) | 929057..930562 | + | 1506 | WP_021339948.1 | PH domain-containing protein | - |
NMQ06_RS04385 (NMQ06_04380) | 930555..931091 | + | 537 | WP_002507105.1 | PH domain-containing protein | - |
NMQ06_RS04390 (NMQ06_04385) | 931124..931474 | + | 351 | WP_021339949.1 | holo-ACP synthase | - |
NMQ06_RS04395 (NMQ06_04390) | 931598..932746 | + | 1149 | WP_021339950.1 | alanine racemase | - |
NMQ06_RS04400 (NMQ06_04395) | 932834..933004 | + | 171 | WP_002507108.1 | type II toxin-antitoxin system antitoxin MazE | Antitoxin |
NMQ06_RS04405 (NMQ06_04400) | 933001..933363 | + | 363 | WP_002511418.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
NMQ06_RS04410 (NMQ06_04405) | 933722..934723 | + | 1002 | WP_002507111.1 | PP2C family protein-serine/threonine phosphatase | - |
NMQ06_RS04415 (NMQ06_04410) | 934803..935129 | + | 327 | WP_002511417.1 | anti-sigma factor antagonist | - |
NMQ06_RS04420 (NMQ06_04415) | 935131..935613 | + | 483 | WP_002507113.1 | anti-sigma B factor RsbW | - |
NMQ06_RS04425 (NMQ06_04420) | 935588..936358 | + | 771 | WP_002507114.1 | RNA polymerase sigma factor SigB | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 121 a.a. Molecular weight: 13432.59 Da Isoelectric Point: 10.2178
>T252154 WP_002511418.1 NZ_CP101472:933001-933363 [Staphylococcus equorum]
MMRRGDVYLADLSPVQGSEQGGIRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKSKYKLDKDSVILLEQIR
TLDKNRLKEKLTYLSESKMKEVNVAIDISLGLHNVRNSKS
MMRRGDVYLADLSPVQGSEQGGIRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKSKYKLDKDSVILLEQIR
TLDKNRLKEKLTYLSESKMKEVNVAIDISLGLHNVRNSKS
Download Length: 363 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|