Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
Location | 3043319..3043883 | Replicon | chromosome |
Accession | NZ_CP101464 | ||
Organism | Janibacter sp. CX7 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | - |
Locus tag | NMQ01_RS14980 | Protein ID | WP_255184697.1 |
Coordinates | 3043319..3043666 (-) | Length | 116 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | - |
Locus tag | NMQ01_RS14985 | Protein ID | WP_255184698.1 |
Coordinates | 3043653..3043883 (-) | Length | 77 a.a. |
Genomic Context
Location: 3039330..3040442 (1113 bp)
Type: Others
Protein ID: WP_255184693.1
Type: Others
Protein ID: WP_255184693.1
Location: 3040486..3041760 (1275 bp)
Type: Others
Protein ID: WP_255184694.1
Type: Others
Protein ID: WP_255184694.1
Location: 3044094..3045446 (1353 bp)
Type: Others
Protein ID: WP_255184699.1
Type: Others
Protein ID: WP_255184699.1
Location: 3045443..3047311 (1869 bp)
Type: Others
Protein ID: WP_255184700.1
Type: Others
Protein ID: WP_255184700.1
Location: 3041902..3042294 (393 bp)
Type: Others
Protein ID: WP_255184695.1
Type: Others
Protein ID: WP_255184695.1
Location: 3042291..3043292 (1002 bp)
Type: Others
Protein ID: WP_255184696.1
Type: Others
Protein ID: WP_255184696.1
Location: 3043319..3043666 (348 bp)
Type: Toxin
Protein ID: WP_255184697.1
Type: Toxin
Protein ID: WP_255184697.1
Location: 3043653..3043883 (231 bp)
Type: Antitoxin
Protein ID: WP_255184698.1
Type: Antitoxin
Protein ID: WP_255184698.1
Location: 3047308..3047706 (399 bp)
Type: Others
Protein ID: WP_255184701.1
Type: Others
Protein ID: WP_255184701.1
Location: 3047703..3047963 (261 bp)
Type: Others
Protein ID: WP_072625853.1
Type: Others
Protein ID: WP_072625853.1
Location: 3047986..3048459 (474 bp)
Type: Others
Protein ID: WP_255184702.1
Type: Others
Protein ID: WP_255184702.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NMQ01_RS14960 (NMQ01_14920) | 3039330..3040442 | + | 1113 | WP_255184693.1 | polysulfide reductase NrfD | - |
NMQ01_RS14965 (NMQ01_14925) | 3040486..3041760 | + | 1275 | WP_255184694.1 | OFA family MFS transporter | - |
NMQ01_RS14970 (NMQ01_14930) | 3041902..3042294 | - | 393 | WP_255184695.1 | rhodanese-like domain-containing protein | - |
NMQ01_RS14975 (NMQ01_14935) | 3042291..3043292 | - | 1002 | WP_255184696.1 | selenide, water dikinase SelD | - |
NMQ01_RS14980 (NMQ01_14940) | 3043319..3043666 | - | 348 | WP_255184697.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
NMQ01_RS14985 (NMQ01_14945) | 3043653..3043883 | - | 231 | WP_255184698.1 | ribbon-helix-helix domain-containing protein | Antitoxin |
NMQ01_RS14995 (NMQ01_14955) | 3044094..3045446 | + | 1353 | WP_255184699.1 | L-seryl-tRNA(Sec) selenium transferase | - |
NMQ01_RS15000 (NMQ01_14960) | 3045443..3047311 | + | 1869 | WP_255184700.1 | SelB C-terminal domain-containing protein | - |
NMQ01_RS15005 (NMQ01_14965) | 3047308..3047706 | - | 399 | WP_255184701.1 | type II toxin-antitoxin system VapC family toxin | - |
NMQ01_RS15010 (NMQ01_14970) | 3047703..3047963 | - | 261 | WP_072625853.1 | type II toxin-antitoxin system prevent-host-death family antitoxin | - |
NMQ01_RS15015 (NMQ01_14975) | 3047986..3048459 | - | 474 | WP_255184702.1 | OsmC family protein | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
No matching records found |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 116 a.a. Molecular weight: 12405.33 Da Isoelectric Point: 11.1401
>T252149 WP_255184697.1 NZ_CP101464:c3043666-3043319 [Janibacter sp. CX7]
MLRGEIRLADLDPVRGSEAAKRRPVLVVSNDVANRSAVRRGRGVVTVVPLTSNTERIFAFQAMLPADRTGLSLDSKAQAE
QVRAIDVQRLGGVIGRVPAALLDEVDDALRLHLGL
MLRGEIRLADLDPVRGSEAAKRRPVLVVSNDVANRSAVRRGRGVVTVVPLTSNTERIFAFQAMLPADRTGLSLDSKAQAE
QVRAIDVQRLGGVIGRVPAALLDEVDDALRLHLGL
Download Length: 348 bp