Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-StbC |
Location | 1528906..1529573 | Replicon | chromosome |
Accession | NZ_CP101417 | ||
Organism | Xanthomonas hortorum strain jj2001 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | NMB96_RS06490 | Protein ID | WP_255086519.1 |
Coordinates | 1528906..1529322 (-) | Length | 139 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | - |
Locus tag | NMB96_RS06495 | Protein ID | WP_255086520.1 |
Coordinates | 1529319..1529573 (-) | Length | 85 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NMB96_RS06455 (NMB96_06440) | 1523942..1525567 | - | 1626 | WP_255086518.1 | alpha/beta hydrolase-fold protein | - |
NMB96_RS06460 (NMB96_06445) | 1525933..1526115 | + | 183 | WP_006448384.1 | helix-turn-helix transcriptional regulator | - |
NMB96_RS06465 (NMB96_06450) | 1526483..1526668 | + | 186 | Protein_1273 | hypothetical protein | - |
NMB96_RS06470 (NMB96_06455) | 1526726..1527178 | + | 453 | WP_183086946.1 | hypothetical protein | - |
NMB96_RS06475 (NMB96_06460) | 1527165..1527602 | - | 438 | WP_023905887.1 | DUF6393 family protein | - |
NMB96_RS06480 (NMB96_06465) | 1527741..1527911 | + | 171 | WP_192824376.1 | hypothetical protein | - |
NMB96_RS06485 (NMB96_06470) | 1528220..1528780 | + | 561 | WP_023905791.1 | hypothetical protein | - |
NMB96_RS06490 (NMB96_06475) | 1528906..1529322 | - | 417 | WP_255086519.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
NMB96_RS06495 (NMB96_06480) | 1529319..1529573 | - | 255 | WP_255086520.1 | Arc family DNA-binding protein | Antitoxin |
NMB96_RS06500 (NMB96_06485) | 1529713..1530825 | - | 1113 | WP_255086521.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
NMB96_RS06505 (NMB96_06490) | 1530812..1531018 | - | 207 | WP_023905787.1 | hypothetical protein | - |
NMB96_RS06510 (NMB96_06495) | 1531299..1531805 | + | 507 | WP_043889571.1 | hypothetical protein | - |
NMB96_RS06515 (NMB96_06500) | 1531872..1533137 | - | 1266 | WP_023905785.1 | phospholipase D-like domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 1494518..1536315 | 41797 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 14824.09 Da Isoelectric Point: 5.1239
>T252142 WP_255086519.1 NZ_CP101417:c1529322-1528906 [Xanthomonas hortorum]
VILLDTNVISELWRPRPNPQVVAWIDAQAVETLFLSVVTVAELRFGIAVMPEGRKRSTLHARLEGEVLPLFDGRLLAFDL
DASHAFATLASKARTAGLTLGRADAYIAATAAAQGLAVATRDTAPFEAMALDVINPWS
VILLDTNVISELWRPRPNPQVVAWIDAQAVETLFLSVVTVAELRFGIAVMPEGRKRSTLHARLEGEVLPLFDGRLLAFDL
DASHAFATLASKARTAGLTLGRADAYIAATAAAQGLAVATRDTAPFEAMALDVINPWS
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|