Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
Location | 3482547..3483132 | Replicon | chromosome |
Accession | NZ_CP101416 | ||
Organism | Pseudanabaena sp. Chao 1811 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | - |
Locus tag | NMG48_RS15975 | Protein ID | WP_271252458.1 |
Coordinates | 3482547..3482915 (-) | Length | 123 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | - |
Locus tag | NMG48_RS15980 | Protein ID | WP_271252459.1 |
Coordinates | 3482908..3483132 (-) | Length | 75 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NMG48_RS15955 | 3478752..3479222 | + | 471 | WP_271252455.1 | hypothetical protein | - |
NMG48_RS15965 | 3479581..3480801 | + | 1221 | WP_271252456.1 | DUF4336 domain-containing protein | - |
NMG48_RS15970 | 3480798..3482363 | - | 1566 | WP_271252457.1 | cytochrome P450 | - |
NMG48_RS15975 | 3482547..3482915 | - | 369 | WP_271252458.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
NMG48_RS15980 | 3482908..3483132 | - | 225 | WP_271252459.1 | hypothetical protein | Antitoxin |
NMG48_RS15985 | 3483384..3483935 | + | 552 | WP_271252460.1 | transposase | - |
NMG48_RS15990 | 3484110..3485489 | - | 1380 | WP_271252461.1 | response regulator | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 123 a.a. Molecular weight: 13779.80 Da Isoelectric Point: 8.9293
>T252140 WP_271252458.1 NZ_CP101416:c3482915-3482547 [Pseudanabaena sp. Chao 1811]
MPNGTLTYKRGEIWWVDLNPTIGSETDKERPCLILQNDIGNQNGLTIIVAPLLPNKKTYPFVVNVVPTPKNGLSGDRHIN
LSQMRSVDARRIKNKQGVLEDIYWKEIEKAVSIELGFNNFSS
MPNGTLTYKRGEIWWVDLNPTIGSETDKERPCLILQNDIGNQNGLTIIVAPLLPNKKTYPFVVNVVPTPKNGLSGDRHIN
LSQMRSVDARRIKNKQGVLEDIYWKEIEKAVSIELGFNNFSS
Download Length: 369 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|