Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) mazEF/PRK09907-MazE
Location 2208256..2208827 Replicon chromosome
Accession NZ_CP101416
Organism Pseudanabaena sp. Chao 1811

Toxin (Protein)


Gene name mazF Uniprot ID -
Locus tag NMG48_RS10090 Protein ID WP_271255090.1
Coordinates 2208256..2208591 (-) Length 112 a.a.

Antitoxin (Protein)


Gene name mazE Uniprot ID -
Locus tag NMG48_RS10095 Protein ID WP_271255091.1
Coordinates 2208585..2208827 (-) Length 81 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NMG48_RS10055 2203660..2203974 - 315 WP_271255085.1 hypothetical protein -
NMG48_RS10060 2204130..2204327 + 198 WP_271255086.1 AbrB/MazE/SpoVT family DNA-binding domain-containing protein -
NMG48_RS10065 2204351..2204719 + 369 WP_271251623.1 transposase -
NMG48_RS10070 2204749..2205297 + 549 Protein_1981 transposase -
NMG48_RS10075 2205411..2205746 + 336 WP_271255087.1 type II toxin-antitoxin system PemK/MazF family toxin -
NMG48_RS10080 2205826..2206047 - 222 WP_271255088.1 hypothetical protein -
NMG48_RS10085 2206194..2208176 + 1983 WP_271255089.1 DUF262 domain-containing protein -
NMG48_RS10090 2208256..2208591 - 336 WP_271255090.1 endoribonuclease MazF Toxin
NMG48_RS10095 2208585..2208827 - 243 WP_271255091.1 AbrB/MazE/SpoVT family DNA-binding domain-containing protein Antitoxin
NMG48_RS10100 2208996..2209244 + 249 WP_271255092.1 hypothetical protein -
NMG48_RS10105 2209587..2210027 + 441 WP_271255093.1 SufE family protein -
NMG48_RS10110 2210059..2211165 - 1107 WP_271255094.1 iron-containing alcohol dehydrogenase family protein -
NMG48_RS10115 2211331..2212407 - 1077 WP_271255095.1 magnesium-protoporphyrin IX monomethyl ester (oxidative) cyclase -
NMG48_RS10120 2212447..2212890 - 444 WP_271255096.1 bacteriohemerythrin -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

mRNA interferase PemK-like

(5-110)

Antitoxin

Antitoxin PemI-like

(1-80)


Sequences

Toxin        


Download         Length: 112 a.a.        Molecular weight: 12520.52 Da        Isoelectric Point: 7.1652

>T252139 WP_271255090.1 NZ_CP101416:c2208591-2208256 [Pseudanabaena sp. Chao 1811]
MVKQYIPDRGDIVWLDFDPQAGHEQSGHRPAFVISPIAYNQRSNLALLCPITSKVKGWKFEVLLTDTKTKGVILADQIKS
LDWQARRIDFIEKASVSIIDEVIGKIEALLT

Download         Length: 336 bp

Antitoxin


Download         Length: 81 a.a.        Molecular weight: 8723.92 Da        Isoelectric Point: 5.5521

>AT252139 WP_271255091.1 NZ_CP101416:c2208827-2208585 [Pseudanabaena sp. Chao 1811]
MTAAIAKWGNSLAVRIPQAIAEQVQIQAGSEINIEIIDGKIVLTPHRRKKYTLDELLDGMTSEHLHAETSTGVSVGNEAW

Download         Length: 243 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References