Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) /BrnT(toxin)
Location 1338678..1339164 Replicon chromosome
Accession NZ_CP101416
Organism Pseudanabaena sp. Chao 1811

Toxin (Protein)


Gene name - Uniprot ID -
Locus tag NMG48_RS06285 Protein ID WP_190402923.1
Coordinates 1338901..1339164 (-) Length 88 a.a.

Antitoxin (Protein)


Gene name - Uniprot ID -
Locus tag NMG48_RS06280 Protein ID WP_271254450.1
Coordinates 1338678..1338911 (-) Length 78 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NMG48_RS06255 1334095..1335276 - 1182 WP_169363454.1 NAD(P)H-quinone oxidoreductase subunit H -
NMG48_RS06260 1335818..1336399 + 582 WP_271255251.1 Uma2 family endonuclease -
NMG48_RS06265 1336590..1336799 + 210 WP_197725135.1 NAD(P)H dehydrogenase subunit NdhS -
NMG48_RS06270 1336966..1337580 + 615 WP_271254448.1 OmpA family protein -
NMG48_RS06275 1337583..1338521 + 939 WP_271254449.1 ribonuclease Z -
NMG48_RS06280 1338678..1338911 - 234 WP_271254450.1 CopG family transcriptional regulator Antitoxin
NMG48_RS06285 1338901..1339164 - 264 WP_190402923.1 BrnT family toxin Toxin
NMG48_RS06290 1339383..1339589 - 207 WP_271254451.1 hypothetical protein -
NMG48_RS06295 1339756..1340364 + 609 Protein_1238 IS256 family transposase -
NMG48_RS06300 1340494..1340754 - 261 WP_271254452.1 hypothetical protein -
NMG48_RS06305 1340951..1341181 - 231 WP_271254453.1 hypothetical protein -
NMG48_RS06310 1341267..1341602 - 336 WP_009626922.1 ribulose bisphosphate carboxylase small subunit -
NMG48_RS06315 1341643..1342131 - 489 WP_271254454.1 chaperonin family protein RbcX -
NMG48_RS06320 1342204..1343634 - 1431 WP_271254455.1 form I ribulose bisphosphate carboxylase large subunit -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- flank IS/Tn - - 1339759..1340364 605


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Ribonuclease toxin, BrnT, of type II toxin-antitoxin system

(6-81)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 88 a.a.        Molecular weight: 10419.73 Da        Isoelectric Point: 9.5900

>T252138 WP_190402923.1 NZ_CP101416:c1339164-1338901 [Pseudanabaena sp. Chao 1811]
MRNFEYDENKSQSNFAKHGIDFVEAQKLWNDPNLLEIPSRIQDEPRFVVIGKINNKHWSGVITYRDQNIRIISVRRSRTQ
EVALYER

Download         Length: 264 bp

Antitoxin


Download         Length: 78 a.a.        Molecular weight: 8782.06 Da        Isoelectric Point: 4.4000

>AT252138 WP_271254450.1 NZ_CP101416:c1338911-1338678 [Pseudanabaena sp. Chao 1811]
MNAKDFDQKFEDGEEDIIEMLDLSQAKRPLAAQKRLSIELPIWMIELINQEAKRLGVTPQTIVQTSLAEHLAVSNFN

Download         Length: 234 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References