Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | /BrnT(toxin) |
| Location | 1338678..1339164 | Replicon | chromosome |
| Accession | NZ_CP101416 | ||
| Organism | Pseudanabaena sp. Chao 1811 | ||
Toxin (Protein)
| Gene name | - | Uniprot ID | - |
| Locus tag | NMG48_RS06285 | Protein ID | WP_190402923.1 |
| Coordinates | 1338901..1339164 (-) | Length | 88 a.a. |
Antitoxin (Protein)
| Gene name | - | Uniprot ID | - |
| Locus tag | NMG48_RS06280 | Protein ID | WP_271254450.1 |
| Coordinates | 1338678..1338911 (-) | Length | 78 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NMG48_RS06255 | 1334095..1335276 | - | 1182 | WP_169363454.1 | NAD(P)H-quinone oxidoreductase subunit H | - |
| NMG48_RS06260 | 1335818..1336399 | + | 582 | WP_271255251.1 | Uma2 family endonuclease | - |
| NMG48_RS06265 | 1336590..1336799 | + | 210 | WP_197725135.1 | NAD(P)H dehydrogenase subunit NdhS | - |
| NMG48_RS06270 | 1336966..1337580 | + | 615 | WP_271254448.1 | OmpA family protein | - |
| NMG48_RS06275 | 1337583..1338521 | + | 939 | WP_271254449.1 | ribonuclease Z | - |
| NMG48_RS06280 | 1338678..1338911 | - | 234 | WP_271254450.1 | CopG family transcriptional regulator | Antitoxin |
| NMG48_RS06285 | 1338901..1339164 | - | 264 | WP_190402923.1 | BrnT family toxin | Toxin |
| NMG48_RS06290 | 1339383..1339589 | - | 207 | WP_271254451.1 | hypothetical protein | - |
| NMG48_RS06295 | 1339756..1340364 | + | 609 | Protein_1238 | IS256 family transposase | - |
| NMG48_RS06300 | 1340494..1340754 | - | 261 | WP_271254452.1 | hypothetical protein | - |
| NMG48_RS06305 | 1340951..1341181 | - | 231 | WP_271254453.1 | hypothetical protein | - |
| NMG48_RS06310 | 1341267..1341602 | - | 336 | WP_009626922.1 | ribulose bisphosphate carboxylase small subunit | - |
| NMG48_RS06315 | 1341643..1342131 | - | 489 | WP_271254454.1 | chaperonin family protein RbcX | - |
| NMG48_RS06320 | 1342204..1343634 | - | 1431 | WP_271254455.1 | form I ribulose bisphosphate carboxylase large subunit | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | flank | IS/Tn | - | - | 1339759..1340364 | 605 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 88 a.a. Molecular weight: 10419.73 Da Isoelectric Point: 9.5900
>T252138 WP_190402923.1 NZ_CP101416:c1339164-1338901 [Pseudanabaena sp. Chao 1811]
MRNFEYDENKSQSNFAKHGIDFVEAQKLWNDPNLLEIPSRIQDEPRFVVIGKINNKHWSGVITYRDQNIRIISVRRSRTQ
EVALYER
MRNFEYDENKSQSNFAKHGIDFVEAQKLWNDPNLLEIPSRIQDEPRFVVIGKINNKHWSGVITYRDQNIRIISVRRSRTQ
EVALYER
Download Length: 264 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|