Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/AbrB(antitoxin) |
Location | 960936..961518 | Replicon | chromosome |
Accession | NZ_CP101416 | ||
Organism | Pseudanabaena sp. Chao 1811 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | - |
Locus tag | NMG48_RS04560 | Protein ID | WP_271254179.1 |
Coordinates | 961168..961518 (+) | Length | 117 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | - |
Locus tag | NMG48_RS04555 | Protein ID | WP_271254178.1 |
Coordinates | 960936..961178 (+) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NMG48_RS04535 | 956668..957453 | + | 786 | WP_271254175.1 | DUF3120 domain-containing protein | - |
NMG48_RS04540 | 957666..959096 | - | 1431 | WP_271254176.1 | MFS transporter | - |
NMG48_RS04545 | 959835..960164 | + | 330 | WP_126388501.1 | thioredoxin | - |
NMG48_RS04550 | 960331..960879 | + | 549 | WP_271254177.1 | bifunctional pyr operon transcriptional regulator/uracil phosphoribosyltransferase PyrR | - |
NMG48_RS04555 | 960936..961178 | + | 243 | WP_271254178.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
NMG48_RS04560 | 961168..961518 | + | 351 | WP_271254179.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
NMG48_RS04565 | 961546..962319 | - | 774 | WP_271254180.1 | precorrin-4 C(11)-methyltransferase | - |
NMG48_RS04570 | 962427..963470 | - | 1044 | WP_271254181.1 | cobalt-precorrin-5B (C(1))-methyltransferase CbiD | - |
NMG48_RS04575 | 963530..965143 | - | 1614 | WP_271254182.1 | SpoIID/LytB domain-containing protein | - |
NMG48_RS04580 | 965341..966411 | - | 1071 | WP_271254183.1 | response regulator | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12832.91 Da Isoelectric Point: 8.7036
>T252137 WP_271254179.1 NZ_CP101416:961168-961518 [Pseudanabaena sp. Chao 1811]
VTFNQFDVVIVPFPFTDTASTKRRPALVISDHVTFNAPTNRSVMAMITTAKHSSWVLDVNILDLPSAGLTYPSIIRMKLF
TLDDVLVIKRIGALSQADRTATQEAIAQLFRLSLEA
VTFNQFDVVIVPFPFTDTASTKRRPALVISDHVTFNAPTNRSVMAMITTAKHSSWVLDVNILDLPSAGLTYPSIIRMKLF
TLDDVLVIKRIGALSQADRTATQEAIAQLFRLSLEA
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|