Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tad-ata/Tad-HTH_37 |
Location | 433612..434326 | Replicon | chromosome |
Accession | NZ_CP101416 | ||
Organism | Pseudanabaena sp. Chao 1811 |
Toxin (Protein)
Gene name | tad | Uniprot ID | - |
Locus tag | NMG48_RS02030 | Protein ID | WP_271253777.1 |
Coordinates | 433955..434326 (-) | Length | 124 a.a. |
Antitoxin (Protein)
Gene name | ata | Uniprot ID | - |
Locus tag | NMG48_RS02025 | Protein ID | WP_271253776.1 |
Coordinates | 433612..433941 (-) | Length | 110 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NMG48_RS01990 | 429290..429940 | + | 651 | WP_271253772.1 | hypothetical protein | - |
NMG48_RS01995 | 429959..430198 | + | 240 | WP_271253773.1 | DUF2281 domain-containing protein | - |
NMG48_RS02000 | 430282..430563 | - | 282 | WP_271253774.1 | Txe/YoeB family addiction module toxin | - |
NMG48_RS02005 | 430550..430834 | - | 285 | WP_271253775.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | - |
NMG48_RS02010 | 430967..431698 | - | 732 | Protein_396 | IS256 family transposase | - |
NMG48_RS02015 | 431780..432991 | + | 1212 | WP_271251719.1 | IS256 family transposase | - |
NMG48_RS02020 | 433034..433513 | - | 480 | Protein_398 | transposase | - |
NMG48_RS02025 | 433612..433941 | - | 330 | WP_271253776.1 | helix-turn-helix transcriptional regulator | Antitoxin |
NMG48_RS02030 | 433955..434326 | - | 372 | WP_271253777.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
NMG48_RS02035 | 434728..434820 | + | 93 | Protein_401 | NADH-quinone oxidoreductase subunit C | - |
NMG48_RS02040 | 434891..435574 | - | 684 | WP_271253778.1 | Uma2 family endonuclease | - |
NMG48_RS02050 | 436018..438276 | + | 2259 | WP_271253779.1 | ABC transporter substrate-binding protein | - |
NMG48_RS02055 | 438383..439168 | + | 786 | WP_271253780.1 | cache domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | flank | IS/Tn | - | - | 430967..431599 | 632 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 124 a.a. Molecular weight: 13874.88 Da Isoelectric Point: 7.3526
>T252136 WP_271253777.1 NZ_CP101416:c434326-433955 [Pseudanabaena sp. Chao 1811]
VSILPLKSVEWIGSSLDDLKDFPDEVQQVVGYALYIAQCGDKHPSAKPLKGFKGAGVVEIVEDFDGDTYRAVYTIKFADV
VYVLHSFQKKSKQGIATPKQDMDLIEARLKRAKEHYAEHYNKK
VSILPLKSVEWIGSSLDDLKDFPDEVQQVVGYALYIAQCGDKHPSAKPLKGFKGAGVVEIVEDFDGDTYRAVYTIKFADV
VYVLHSFQKKSKQGIATPKQDMDLIEARLKRAKEHYAEHYNKK
Download Length: 372 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|