Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
| Location | 4419158..4419939 | Replicon | chromosome |
| Accession | NZ_CP101390 | ||
| Organism | Salmonella enterica strain SC2017297 | ||
Toxin (Protein)
| Gene name | TacT2 | Uniprot ID | E8X9W8 |
| Locus tag | NMU39_RS21715 | Protein ID | WP_000626099.1 |
| Coordinates | 4419158..4419649 (-) | Length | 164 a.a. |
Antitoxin (Protein)
| Gene name | TacA2 | Uniprot ID | B5R979 |
| Locus tag | NMU39_RS21720 | Protein ID | WP_001110452.1 |
| Coordinates | 4419646..4419939 (-) | Length | 98 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NMU39_RS21680 (4415153) | 4415153..4415728 | + | 576 | WP_001188509.1 | transcriptional regulator | - |
| NMU39_RS21690 (4415999) | 4415999..4416076 | - | 78 | Protein_4242 | helix-turn-helix domain-containing protein | - |
| NMU39_RS21695 (4416167) | 4416167..4416499 | - | 333 | WP_001165471.1 | MerR family transcriptional regulator | - |
| NMU39_RS21700 (4416571) | 4416571..4416948 | + | 378 | WP_000916345.1 | EthD family reductase | - |
| NMU39_RS21705 (4417981) | 4417981..4418055 | + | 75 | Protein_4245 | porin family protein | - |
| NMU39_RS21710 (4418158) | 4418158..4418910 | + | 753 | WP_000842434.1 | non-specific acid phosphatase | - |
| NMU39_RS21715 (4419158) | 4419158..4419649 | - | 492 | WP_000626099.1 | GNAT family N-acetyltransferase | Toxin |
| NMU39_RS21720 (4419646) | 4419646..4419939 | - | 294 | WP_001110452.1 | DUF1778 domain-containing protein | Antitoxin |
| NMU39_RS21725 (4420256) | 4420256..4420477 | + | 222 | WP_001576552.1 | hypothetical protein | - |
| NMU39_RS21730 (4420742) | 4420742..4421617 | + | 876 | WP_000921674.1 | AraC family transcriptional regulator | - |
| NMU39_RS21735 (4421614) | 4421614..4421901 | + | 288 | WP_001269916.1 | transcriptional regulator RtsB | - |
| NMU39_RS21740 (4421924) | 4421924..4422139 | + | 216 | WP_001595136.1 | hypothetical protein | - |
| NMU39_RS21745 (4422147) | 4422147..4422416 | + | 270 | WP_010989096.1 | hypothetical protein | - |
| NMU39_RS21750 (4422710) | 4422710..4423615 | - | 906 | WP_001268200.1 | YjiK family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 164 a.a. Molecular weight: 17646.39 Da Isoelectric Point: 6.8437
>T252129 WP_000626099.1 NZ_CP101390:c4419649-4419158 [Salmonella enterica]
MISTPEPLHAGHILTPFCCGVDSIDNWLEQRAMKNQTTGASRTFVCCGSDSNVLAYYSLASSAVTTNTSPGRFRRNMPDP
IPVVVLGRLAVDKSLHGQGVARALVRDAGLRVIQVAETIGIRGMLVHALSDEAREFYQRVGFVPSPMDPMMLMVTLGDLV
ESV
MISTPEPLHAGHILTPFCCGVDSIDNWLEQRAMKNQTTGASRTFVCCGSDSNVLAYYSLASSAVTTNTSPGRFRRNMPDP
IPVVVLGRLAVDKSLHGQGVARALVRDAGLRVIQVAETIGIRGMLVHALSDEAREFYQRVGFVPSPMDPMMLMVTLGDLV
ESV
Download Length: 492 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| PDB | 7AK7 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| PDB | 7AK7 | |
| AlphaFold DB | A0A5I1DGA4 |