Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 3576643..3577263 | Replicon | chromosome |
Accession | NZ_CP101390 | ||
Organism | Salmonella enterica strain SC2017297 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | V1H8E6 |
Locus tag | NMU39_RS17765 | Protein ID | WP_001280991.1 |
Coordinates | 3577045..3577263 (+) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | V1H4V6 |
Locus tag | NMU39_RS17760 | Protein ID | WP_000344807.1 |
Coordinates | 3576643..3577017 (+) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NMU39_RS17750 (3571782) | 3571782..3572975 | + | 1194 | WP_001039202.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
NMU39_RS17755 (3572998) | 3572998..3576147 | + | 3150 | WP_001132508.1 | efflux RND transporter permease AcrB | - |
NMU39_RS17760 (3576643) | 3576643..3577017 | + | 375 | WP_000344807.1 | Hha toxicity modulator TomB | Antitoxin |
NMU39_RS17765 (3577045) | 3577045..3577263 | + | 219 | WP_001280991.1 | HHA domain-containing protein | Toxin |
NMU39_RS17770 (3577442) | 3577442..3577993 | + | 552 | WP_001278792.1 | maltose O-acetyltransferase | - |
NMU39_RS17775 (3578110) | 3578110..3578580 | + | 471 | WP_000136181.1 | YlaC family protein | - |
NMU39_RS17780 (3578636) | 3578636..3578776 | - | 141 | WP_001197749.1 | type B 50S ribosomal protein L36 | - |
NMU39_RS17785 (3578782) | 3578782..3579042 | - | 261 | WP_000801415.1 | type B 50S ribosomal protein L31 | - |
NMU39_RS17790 (3579267) | 3579267..3580817 | + | 1551 | WP_000213139.1 | EAL domain-containing protein | - |
NMU39_RS17800 (3581048) | 3581048..3581437 | + | 390 | WP_000961285.1 | MGMT family protein | - |
NMU39_RS17805 (3581470) | 3581470..3582039 | - | 570 | WP_000779803.1 | YbaY family lipoprotein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8613.97 Da Isoelectric Point: 8.9008
>T252124 WP_001280991.1 NZ_CP101390:3577045-3577263 [Salmonella enterica]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14453.27 Da Isoelectric Point: 5.1444
>AT252124 WP_000344807.1 NZ_CP101390:3576643-3577017 [Salmonella enterica]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|