Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 4444258..4445039 | Replicon | chromosome |
Accession | NZ_CP101388 | ||
Organism | Salmonella enterica strain SC2017167 |
Toxin (Protein)
Gene name | TacT2 | Uniprot ID | E8X9W8 |
Locus tag | NMU38_RS21835 | Protein ID | WP_000626099.1 |
Coordinates | 4444258..4444749 (-) | Length | 164 a.a. |
Antitoxin (Protein)
Gene name | TacA2 | Uniprot ID | B5R979 |
Locus tag | NMU38_RS21840 | Protein ID | WP_001110452.1 |
Coordinates | 4444746..4445039 (-) | Length | 98 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NMU38_RS21795 (4439444) | 4439444..4439686 | - | 243 | WP_197603740.1 | hypothetical protein | - |
NMU38_RS21800 (4439683) | 4439683..4440039 | - | 357 | WP_033567083.1 | hypothetical protein | - |
NMU38_RS21805 (4440036) | 4440036..4440908 | - | 873 | WP_033567082.1 | ParA family protein | - |
NMU38_RS21810 (4441099) | 4441099..4441176 | - | 78 | Protein_4266 | helix-turn-helix domain-containing protein | - |
NMU38_RS21815 (4441267) | 4441267..4441599 | - | 333 | WP_001165471.1 | MerR family transcriptional regulator | - |
NMU38_RS21820 (4441671) | 4441671..4442048 | + | 378 | WP_000916345.1 | EthD family reductase | - |
NMU38_RS21825 (4443081) | 4443081..4443155 | + | 75 | Protein_4269 | porin family protein | - |
NMU38_RS21830 (4443258) | 4443258..4444010 | + | 753 | WP_000842434.1 | non-specific acid phosphatase | - |
NMU38_RS21835 (4444258) | 4444258..4444749 | - | 492 | WP_000626099.1 | GNAT family N-acetyltransferase | Toxin |
NMU38_RS21840 (4444746) | 4444746..4445039 | - | 294 | WP_001110452.1 | DUF1778 domain-containing protein | Antitoxin |
NMU38_RS21845 (4445356) | 4445356..4445577 | + | 222 | WP_001576552.1 | hypothetical protein | - |
NMU38_RS21850 (4445842) | 4445842..4446717 | + | 876 | WP_000921674.1 | AraC family transcriptional regulator | - |
NMU38_RS21855 (4446714) | 4446714..4447001 | + | 288 | WP_001269916.1 | transcriptional regulator RtsB | - |
NMU38_RS21860 (4447024) | 4447024..4447239 | + | 216 | WP_001595136.1 | hypothetical protein | - |
NMU38_RS21865 (4447247) | 4447247..4447516 | + | 270 | WP_010989096.1 | hypothetical protein | - |
NMU38_RS21870 (4447810) | 4447810..4448715 | - | 906 | WP_001268200.1 | YjiK family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 164 a.a. Molecular weight: 17646.39 Da Isoelectric Point: 6.8437
>T252109 WP_000626099.1 NZ_CP101388:c4444749-4444258 [Salmonella enterica]
MISTPEPLHAGHILTPFCCGVDSIDNWLEQRAMKNQTTGASRTFVCCGSDSNVLAYYSLASSAVTTNTSPGRFRRNMPDP
IPVVVLGRLAVDKSLHGQGVARALVRDAGLRVIQVAETIGIRGMLVHALSDEAREFYQRVGFVPSPMDPMMLMVTLGDLV
ESV
MISTPEPLHAGHILTPFCCGVDSIDNWLEQRAMKNQTTGASRTFVCCGSDSNVLAYYSLASSAVTTNTSPGRFRRNMPDP
IPVVVLGRLAVDKSLHGQGVARALVRDAGLRVIQVAETIGIRGMLVHALSDEAREFYQRVGFVPSPMDPMMLMVTLGDLV
ESV
Download Length: 492 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
PDB | 7AK7 |
Antitoxin
Source | ID | Structure |
---|---|---|
PDB | 7AK7 | |
AlphaFold DB | A0A5I1DGA4 |