Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 3519664..3520284 | Replicon | chromosome |
Accession | NZ_CP101388 | ||
Organism | Salmonella enterica strain SC2017167 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | V1H8E6 |
Locus tag | NMU38_RS17445 | Protein ID | WP_001280991.1 |
Coordinates | 3520066..3520284 (+) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | V1H4V6 |
Locus tag | NMU38_RS17440 | Protein ID | WP_000344807.1 |
Coordinates | 3519664..3520038 (+) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NMU38_RS17430 (3514803) | 3514803..3515996 | + | 1194 | WP_001039202.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
NMU38_RS17435 (3516019) | 3516019..3519168 | + | 3150 | WP_001132508.1 | efflux RND transporter permease AcrB | - |
NMU38_RS17440 (3519664) | 3519664..3520038 | + | 375 | WP_000344807.1 | Hha toxicity modulator TomB | Antitoxin |
NMU38_RS17445 (3520066) | 3520066..3520284 | + | 219 | WP_001280991.1 | HHA domain-containing protein | Toxin |
NMU38_RS17450 (3520463) | 3520463..3521014 | + | 552 | WP_001278792.1 | maltose O-acetyltransferase | - |
NMU38_RS17455 (3521131) | 3521131..3521601 | + | 471 | WP_000136181.1 | YlaC family protein | - |
NMU38_RS17460 (3521657) | 3521657..3521797 | - | 141 | WP_001197749.1 | type B 50S ribosomal protein L36 | - |
NMU38_RS17465 (3521803) | 3521803..3522063 | - | 261 | WP_000801415.1 | type B 50S ribosomal protein L31 | - |
NMU38_RS17470 (3522288) | 3522288..3523838 | + | 1551 | WP_000213139.1 | EAL domain-containing protein | - |
NMU38_RS17480 (3524069) | 3524069..3524458 | + | 390 | WP_000961285.1 | MGMT family protein | - |
NMU38_RS17485 (3524491) | 3524491..3525060 | - | 570 | WP_000779803.1 | YbaY family lipoprotein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8613.97 Da Isoelectric Point: 8.9008
>T252104 WP_001280991.1 NZ_CP101388:3520066-3520284 [Salmonella enterica]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14453.27 Da Isoelectric Point: 5.1444
>AT252104 WP_000344807.1 NZ_CP101388:3519664-3520038 [Salmonella enterica]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|